2F5J: MRG domain from human MRG15

Crystal structure of MRG domain from human MRG15. Determined by X-ray diffraction at 2.2 Å resolution. Released 14 Nov 2006.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,836
Mol. weight: 42.29 kDa
Released: 14 Nov 2006

Explore 2F5J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F5J contains 31 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	158-161	4
α-helix	162-164	3
α-helix	165-176	12
β-strand	180-182	3	1
β-strand	189	1	2
α-helix	190-202	13
α-helix	213-232	20
α-helix	236-238	3
α-helix	239-248	10
α-helix	254-257	4
β-strand	259	1	2
α-helix	260-274	15
α-helix	281-300	20
α-helix	302-305	4
α-helix	308-310	3
β-strand	311-313	3	1
α-helix	314-315	2
α-helix	316-319	4

Chain B: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	158-161	4
α-helix	162-164	3
α-helix	165-172	8
α-helix	173-177	5
β-strand	180-182	3	3
β-strand	189	1	4
α-helix	190-201	12
α-helix	214-232	19
α-helix	236-238	3
α-helix	239-248	10
α-helix	254-257	4
β-strand	259	1	4
α-helix	260-269	10
α-helix	270-272	3
α-helix	277-279	3
α-helix	281-300	20
α-helix	302-305	4
α-helix	308-310	3
β-strand	311-313	3	3
α-helix	314-315	2
α-helix	316-320	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mortality factor 4-like protein 1	A, B	protein	181	Homo sapiens	Q9UBU8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2F5J_1 Mortality factor 4-like protein 1 (chains A, B)
MNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK
EYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRI
GAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAVLEHHHHH
H

Primary citation

The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14. Zhang, P., Zhao, J., Wang, B. et al. Protein Sci (2006) 15:2423-2434. DOI 10.1110/ps.062397806 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F5K 2.2 Å, Crystal structure of the chromo domain of human MRG15
2AQL 2.3 Å, Crystal Structure of the MRG15 MRG domain
6INE 2.6 Å, Crystal Structure of human ASH1L-MRG15 complex
7S4A 2.69 Å, MRG15 complex with PALB2 peptide
6AGO 3.1 Å, Crystal structure of MRG15-ASH1L Histone methyltransferase complex
8C60 3.4 Å, Cryo-EM structure of the human SIN3B full-length complex at 3.4 Angstrom resolution
8BPA 3.7 Å, Cryo-EM structure of the human SIN3B histone deacetylase complex at 3.7 Angstrom
2EFI Solution structure of the chromo domain of Mortality factor 4-like protein 1 from human
2LKM Structural Basis for Molecular Interactions Involving MRG Domains: Implications in…
2N1D Solution structure of the MRG15-MRGBP complex

Browse structure collections

About this viewer

MolViewer shows 2F5J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.