2EKF: RUH-075, a human CUE domain

Solution structure of RUH-075, a human CUE domain. Determined by solution NMR. Released 25 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 441
Mol. weight: 6.32 kDa
Released: 25 Sept 2007

Explore 2EKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EKF contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	13-23	11
α-helix	29-37	9
α-helix	42-50	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ancient ubiquitous protein 1	A	protein	61	Homo sapiens	Q9Y679 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EKF_1 Ancient ubiquitous protein 1 (chains A)
GSSGSSGSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPED
I

Primary citation

Solution structure of RUH-075, a human CUE domain. Ruhul Momen, A.Z.M., Hirota, H., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LEW 1.74 Å, Crystal structure of UBE2G2 in complex with the UBE2G2-binding region of AUP1

Browse structure collections

About this viewer

MolViewer shows 2EKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.