Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3. Determined by solution NMR. Released 2 Oct 2007.
Explore 2EQG in 3D Show helices and sheets RCSB PDB PDBe
2EQG contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13 | 1 | 1 |
| α-helix | 14 | 1 | |
| β-strand | 22 | 1 | 1 |
| α-helix | 23 | 1 | |
| α-helix | 32-39 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor necrosis factor, alpha-induced protein 3 | A | protein | 49 | Homo sapiens | P21580 (AlphaFold model) |
>2EQG_1 Tumor necrosis factor, alpha-induced protein 3 (chains A) GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3. Zhang, H.P., Hayashi, F., Yokoyama, S. To be published.
Other PDB entries of the same protein (UniProt P21580 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2EQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.