2EQG: Tumor necrosis factor, alpha-induced protein 3

Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3. Determined by solution NMR. Released 2 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 359
Mol. weight: 5.28 kDa
Ligands: ZN
Released: 2 Oct 2007

Explore 2EQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EQG contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
α-helix	14	1
β-strand	22	1	1
α-helix	23	1
α-helix	32-39	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor, alpha-induced protein 3	A	protein	49	Homo sapiens	P21580 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EQG_1 Tumor necrosis factor, alpha-induced protein 3 (chains A)
GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3. Zhang, H.P., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt P21580 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VUX 1.7 Å, Crystal structure of A20 ZF7 in complex with linear ubiquitin, form II
3ZJE 1.84 Å, A20 OTU domain in reversibly oxidised (SOH) state
3ZJD 1.87 Å, A20 OTU domain in reduced, active state at 1.87 A resolution
3ZJG 1.92 Å, A20 OTU domain with irreversibly oxidised Cys103 from 60 min H2O2 soak.
3VUW 1.95 Å, Crystal structure of A20 ZF7 in complex with linear ubiquitin, form I
3VUY 1.98 Å, Crystal structure of A20 ZF7 in complex with linear tetraubiquitin
3ZJF 2.2 Å, A20 OTU domain with irreversibly oxidised Cys103 from 270 min H2O2 soak.
3DKB 2.5 Å, Crystal Structure of A20, 2.5 angstrom
3OJ3 2.5 Å, Crystal structure of the A20 ZnF4 and ubiquitin complex
5V3P 2.5 Å, Human A20 OTU domain (I325N) with acetamidylated C103
5LRX 2.85 Å, Structure of A20 OTU domain bound to ubiquitin
5V3B 3.0 Å, Human A20 OTU domain (WT) with acetamidylated C103

Browse structure collections

About this viewer

MolViewer shows 2EQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.