2EQX: Kelch repeat and BTB domain-containing protein 4

Solution structure of the BACK domain of Kelch repeat and BTB domain-containing protein 4. Determined by solution NMR. Released 2 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 819
Mol. weight: 11.68 kDa
Released: 2 Oct 2007

Explore 2EQX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EQX contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	163-172	10
α-helix	176-188	13
α-helix	191-194	4
α-helix	197-201	5
α-helix	204-212	9
β-strand	215-216	2	1
α-helix	221-230	10
α-helix	233-246	14
β-strand	249-250	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch repeat and BTB domain-containing protein 4	A	protein	105	Homo sapiens	Q9NVX7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EQX_1 Kelch repeat and BTB domain-containing protein 4 (chains A)
GSSGSSGVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDI
ISDGVPCSQNPTEAIEAWINFNKEEREAFAESLRTSLKEIGENVH

Primary citation

Solution structure of the BACK domain of Kelch repeat and BTB domain-containing protein 4. Imai, M., Suzuki, S., Muto, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NVX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GGM 2.71 Å, Cryo-EM structure of KBTBD4 P313PRR mutant-HDAC2 2:2 complex
9DTQ 2.87 Å, The structure of HDAC2-CoREST in complex with KBTBD4R313PRR mutant
9GGN 2.9 Å, Cryo-EM structure of KBTBD4 WT-HDAC2 2:2 complex mediated by molecular glue UM171
9GGL 3.13 Å, Cryo-EM structure of KBTBD4 WT-HDAC2 2:1 complex mediated by molecular glue UM171
8VPQ 3.3 Å, The structure of LSD1-CoREST-HDAC1 in complex with KBTBD4IPR310delinsTTYML
9I2C 3.3 Å, Cryo-EM structure of KBTBD4 WT-HDAC2-CoREST1 2:1:1 complex mediated by molecular glue…
8VRT 3.42 Å, The structure of LSD1-CoREST-HDAC1 in complex with KBTBD4R313PRR mutant
8VOJ 3.77 Å, The Cryo-EM structure of LSD1-CoREST-HDAC1 in complex with KBTBD4 enhanced by UM171 and…
9DTG 3.83 Å, The cryo-EM structure of apo KBTBD4

Browse structure collections

About this viewer

MolViewer shows 2EQX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.