2EVW: GTPase HRas

Crystal structure analysis of a fluorescent form of H-Ras p21 in complex with R-caged GTP. Determined by X-ray diffraction at 1.05 Å resolution. Released 30 May 2006.

Method: X-ray diffraction
Resolution: 1.05 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,621
Mol. weight: 19.79 kDa
Ligands: XY2, CAG, MG
Released: 30 May 2006

Explore 2EVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EVW contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	16-25	10
β-strand	38-46	9	1
β-strand	49-57	9	1
α-helix	66-72	7
β-strand	77-83	7	1
α-helix	87-91	5
α-helix	93-104	12
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
α-helix	152-165	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTPase HRas	X	protein	166	Homo sapiens	P01112 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>2EVW_1 GTPase HRas (chains X)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH

Ligands and cofactors

ID	Name	Formula	Copies
XY2	N,n'-dimethyl-N-(acetyl)-N'-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)ethylenediamine	C12 H15 N5 O4	1
CAG	Guanosine 5'-triphosphate P3-[1-(2-nitrophenyl)ethyl ester]	C18 H23 N6 O16 P3	1
MG	Magnesium ion	Mg	1

Primary citation

A newly designed microspectrofluorometer for kinetic studies on protein crystals in combination with x-ray diffraction. Klink, B.U., Goody, R.S., Scheidig, A.J. Biophys J (2006) 91:981-992. DOI 10.1529/biophysj.105.078931 · PubMed

Other PDB entries of the same protein (UniProt P01112 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CE2 1.0 Å, Crystal structure analysis of a fluorescent form of H-ras P21 in complex with GDP
24SQ 1.08 Å, Human HRAS WT (GDP-bound) in complex with macrocyclic peptide inhibitor AP6296
8TBG 1.2 Å, Tricomplex of RMC-7977, HRAS WT, and CypA
2CLD 1.22 Å, Crystal structure analysis of a fluorescent form of H-ras P21 in complex with GDP (2)
2CL6 1.24 Å, Crystal structure analysis of a fluorescent form of H-ras P21 in complex with S-caged GTP
2CL7 1.25 Å, Crystal structure analysis of a fluorescent form of H-ras P21 in complex with GTP
5WDQ 1.25 Å, H-Ras mutant L120A bound to GMP-PNP at 100K
1CTQ 1.26 Å, Structure of P21RAS in complex with gppnhp at 100 K
2CLC 1.3 Å, Crystal structure analysis of a fluorescent form of H-ras P21 in complex with GTP (2)
3K8Y 1.3 Å, Allosteric modulation of H-Ras GTPase
3OIW 1.3 Å, H-RasG12V with allosteric switch in the "on" state
3TGP 1.31 Å, Room temperature H-ras

Browse structure collections

About this viewer

MolViewer shows 2EVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.