2EX4: Human methyltransferase AD-003

Name: PDB 2EX4: Crystal Structure of Human methyltransferase AD-003 in complex with S-adenosyl-L-homocysteine
Published: 2005-11-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal Structure of Human methyltransferase AD-003 in complex with S-adenosyl-L-homocysteine. Determined by X-ray diffraction at 1.75 Å resolution. Released 15 Nov 2005.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,135
Mol. weight: 55.41 kDa
Ligands: SAH
Released: 15 Nov 2005

Explore 2EX4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EX4 contains 32 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
α-helix	9-21	13
α-helix	27-30	4
α-helix	35-37	3
α-helix	38-50	13
α-helix	51-53	3
β-strand	65-69	5	1
α-helix	75-76	2
α-helix	77-81	5
β-strand	87-92	6	1
α-helix	95-104	10
α-helix	106-111	6
β-strand	112-117	6	1
α-helix	120-122	3
α-helix	125-126	2
β-strand	130-136	7	1
α-helix	139-141	3
α-helix	144-157	14
β-strand	158-170	13	1
β-strand	171	1	2
β-strand	175-178	4	3
β-strand	183-186	4	3
β-strand	187	1	2
α-helix	188-197	10
β-strand	202-207	6	1
α-helix	216	1
β-strand	217-223	7	1

Chain B: 16 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	9-21	13
α-helix	27-30	4
α-helix	35-37	3
α-helix	38-53	16
β-strand	65-69	5	4
α-helix	75-76	2
α-helix	77-81	5
α-helix	82-84	3
β-strand	87-92	6	4
α-helix	95-104	10
α-helix	106-111	6
β-strand	112-117	6	4
α-helix	120-122	3
α-helix	125-126	2
β-strand	130-136	7	4
α-helix	139-141	3
α-helix	144-157	14
β-strand	158-171	14	4
β-strand	175-178	4	4
β-strand	183-187	5	4
α-helix	188-197	10
β-strand	202-207	6	4
α-helix	216	1
β-strand	217-223	7	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
adrenal gland protein AD-003	A, B	protein	241	Homo sapiens	Q9BV86 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2EX4_1 adrenal gland protein AD-003 (chains A, B)
MGSSHHHHHHSSGLVPRGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDI
NSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKT
YLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPNGI
IVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFAL
R

Ligands and cofactors

ID	Name	Formula	Copies
SAH	S-adenosyl-L-homocysteine	C14 H20 N6 O5 S	2

Primary citation

The Crystal Structure of Human AD-003 protein in complex with S-adenosyl-L-homocysteine. Min, J., Wu, H., Zeng, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BV86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CVD 1.3 Å, Crystal structure of human NRMT1 in complex with alpha-N-dimethylated human CENP-A peptide
6WJ7 1.42 Å, The structure of NTMT1 in complex with compound C2A
5E1D 1.45 Å, NTMT1 in complex with YPKRIA peptide
6DTN 1.48 Å, The structure of NTMT1 in complex with compound DC100-1
6KDQ 1.5 Å, Crystal structure of human NRMT1 in complex with alpha-N-monomethylated human CENP-A…
5CVE 1.5 Å, Crystal Structure of human NRMT1 in complex with dimethylated fly H2B peptide and SAH
6PVB 1.5 Å, The structure of NTMT1 in complex with compound 6
5E1B 1.65 Å, Crystal structure of NRMT1 in complex with SPKRIA peptide
6WH8 1.73 Å, The structure of NTMT1 in complex with compound BM-30
5E1M 1.75 Å, Crystal structure of NTMT1 in complex with PPKRIA peptide
5E2A 1.75 Å, Crystal structure of NTMT1 in complex with N-terminally methylated SPKRIA peptide
6PVA 1.84 Å, The structure of NTMT1 in complex with compound 11

Browse structure collections

About this viewer

MolViewer shows 2EX4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.