Amino terminal domain of enzyme I from escherichia coli, NMR, restrained regularized mean structure. Determined by solution NMR. Released 20 Aug 1997.
Explore 2EZA in 3D Show helices and sheets RCSB PDB PDBe
2EZA contains 12 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 12-18 | 7 | 1 |
| α-helix | 22-24 | 3 | |
| α-helix | 33-64 | 32 | |
| α-helix | 67-69 | 3 | |
| α-helix | 70-80 | 11 | |
| α-helix | 83-95 | 13 | |
| α-helix | 100-116 | 17 | |
| α-helix | 121-141 | 21 | |
| α-helix | 149-151 | 3 | |
| β-strand | 156-160 | 5 | 1 |
| α-helix | 165-170 | 6 | |
| β-strand | 176-181 | 6 | 1 |
| β-strand | 182 | 1 | 2 |
| α-helix | 189-196 | 8 | |
| β-strand | 201-202 | 2 | 1 |
| β-strand | 204 | 1 | 2 |
| α-helix | 208-210 | 3 | |
| β-strand | 217-220 | 4 | 1 |
| β-strand | 227-229 | 3 | 1 |
| α-helix | 233-254 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphotransferase system, enzyme I | A | protein | 259 | Escherichia coli | P08839 (AlphaFold model) |
>2EZA_1 PHOSPHOTRANSFERASE SYSTEM, ENZYME I (chains A) MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR AVQEQVASEKAELAKLKDR
Defining long range order in NMR structure determination from the dependence of heteronuclear relaxation times on rotational diffusion anisotropy. Tjandra, N., Garrett, D.S., Gronenborn, A.M. et al. Nat Struct Biol (1997) 4:443-449. DOI 10.1038/nsb0697-443 · PubMed
Other PDB entries of the same protein (UniProt P08839 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2EZA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.