Crystal structure of the TRAF-like domain of HAUSP/USP7 bound to a MDM2 peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 7 Feb 2006.
Explore 2F1Y in 3D Show helices and sheets RCSB PDB PDBe
2F1Y contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 68-75 | 8 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 85-86 | 2 | 2 |
| α-helix | 87-89 | 3 | |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 95-104 | 10 | 2 |
| β-strand | 114-121 | 8 | 2 |
| β-strand | 132-140 | 9 | 1 |
| α-helix | 146-148 | 3 | |
| β-strand | 150-158 | 9 | 1 |
| β-strand | 159 | 1 | 3 |
| β-strand | 162 | 1 | 3 |
| β-strand | 164-172 | 9 | 2 |
| α-helix | 173-177 | 5 | |
| β-strand | 185 | 1 | 4 |
| β-strand | 188 | 1 | 4 |
| β-strand | 189-197 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| HAUSP/USP7 | A | protein | 159 | Homo sapiens | Q93009 (AlphaFold model) |
>2F1Y_1 HAUSP/USP7 (chains A) GSHMNTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPD RPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFS NFMAWSEVTDPEKGFIDDDKVTFEVFVQADLDAGVSEHS
Structural Basis of Competitive Recognition of p53 and MDM2 by HAUSP/USP7: Implications for the Regulation of the p53-MDM2 Pathway. Hu, M., Gu, L., Li, M. et al. PLoS Biol (2006) 4:e27-e27. DOI 10.1371/journal.pbio.0040027 · PubMed
Other PDB entries of the same protein (UniProt Q93009 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2F1Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.