2XXN: VIRF4-HAUSP TRAF domain complex

Structure of the vIRF4-HAUSP TRAF domain complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 9 Nov 2011.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: HOMO SAPIENS, HUMAN HERPESVIRUS 8
Chains: 2
Atoms: 1,560
Mol. weight: 18.35 kDa
Released: 9 Nov 2011

Explore 2XXN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XXN contains 6 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	68-75	8	1
α-helix	78-80	3
β-strand	85-86	2	2
α-helix	87-89	3
β-strand	90-92	3	2
β-strand	95-104	10	2
β-strand	114-121	8	2
β-strand	131-140	10	1
β-strand	150-159	10	1
β-strand	162	1	1
β-strand	164-172	9	2
α-helix	173-176	4
α-helix	179-181	3
β-strand	184-185	2	1
β-strand	188-197	10	1
α-helix	198-200	3
β-strand	201	1	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	206	1
β-strand	212	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 7	A	protein	143	HOMO SAPIENS	Q93009 (AlphaFold model)
K10	B	protein	15	HUMAN HERPESVIRUS 8	Q2HR73 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XXN_1 UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 7 (chains A)
TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCN
AESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKG
FIDDDKVTFEVFVQADAPHGVAW

Sequence of entity 2 (B), FASTA

>2XXN_2 K10 (chains B)
SVWIPVNEGASTSGM

Primary citation

Bilateral Inhibition of Hausp Deubiquitinase by a Viral Interferon Regulatory Factor Protein. Lee, H.R., Choi, W.C., Lee, S. et al. Nat Struct Mol Biol (2011) 18:1336. DOI 10.1038/NSMB.2142 · PubMed

Other PDB entries of the same protein (UniProt Q93009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YSI 1.02 Å, Structure of USP7 with a novel viral protein
5KYC 1.43 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin…
5KYF 1.45 Å, Crystal structure of USP7 catalytic domain [L299A] mutant in complex with ubiquitin
2FOJ 1.6 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with p53 peptide…
5KYD 1.62 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin
12ZJ 1.63 Å, Crystal structure of USP7 TRAF domain in complex with MAGEL2 peptide (968-980)
2F1W 1.65 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7
1YY6 1.7 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with an EBNA1…
2F1Y 1.7 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7 bound to a MDM2 peptide
4KG9 1.7 Å, Crystal Structure Of USP7-NTD with MCM-BP
5N9T 1.73 Å, Crystal structure of USP7 in complex with a potent, selective and reversible…
9DEM 1.77 Å, USP7 in complex with macrocycle MC04

Browse structure collections

About this viewer

MolViewer shows 2XXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.