The solution structure of the REF2-I mRNA export factor (residues 1-155). Determined by solution NMR. Released 31 Oct 2006.
Explore 2F3J in 3D Show helices and sheets RCSB PDB PDBe
2F3J contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-17 | 9 | |
| β-strand | 75-80 | 6 | 1 |
| α-helix | 88-97 | 10 | |
| β-strand | 103-106 | 4 | 1 |
| β-strand | 118-122 | 5 | 1 |
| α-helix | 125-134 | 10 | |
| β-strand | 139 | 1 | 2 |
| β-strand | 144 | 1 | 2 |
| β-strand | 146-150 | 5 | 1 |
| α-helix | 153-156 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA and export factor binding protein 2 | A | protein | 177 | Mus musculus | Q9JJW6 (AlphaFold model) |
>2F3J_1 RNA and export factor binding protein 2 (chains A) MASMTGGQQMGRDPMADKMDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARGGRNRPAPY SRPKPLPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAV DYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEHHHHHH
The solution structure of REF2-I reveals interdomain interactions and regions involved in binding mRNA export factors and RNA. Golovanov, A.P., Hautbergue, G.M., Tintaru, A.M. et al. RNA (2006) 12:1933-1948. DOI 10.1261/rna.212106 · PubMed
Other PDB entries of the same protein (UniProt Q9JJW6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2F3J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.