2F4K: Villin-1

Chicken villin subdomain HP-35, K65(NLE), N68H, K70(NLE), PH9. Determined by X-ray diffraction at 1.05 Å resolution. Released 11 Apr 2006.

Method: X-ray diffraction
Resolution: 1.05 Å
Chains: 1
Atoms: 359
Mol. weight: 4.06 kDa
Released: 11 Apr 2006

Explore 2F4K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F4K contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	44-51	8
α-helix	55-60	6
α-helix	63-73	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Villin-1	A	protein	35		P02640 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2F4K_1 Villin-1 (chains A)
LSDEDFKAVFGMTRSAFANLPLWLQQHLLKEKGLF

Primary citation

Sub-microsecond Protein Folding. Kubelka, J., Chiu, T.K., Davies, D.R. et al. J Mol Biol (2006) 359:546-553. DOI 10.1016/j.jmb.2006.03.034 · PubMed

Other PDB entries of the same protein (UniProt P02640 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WY3 0.95 Å, Chicken villin subdomain HP-35, K65(NLE), N68H, pH7.0
1YRI 1.0 Å, Chicken villin subdomain HP-35, N68H, pH6.4
3TRV 1.0 Å, Crystal structure of quasiracemic villin headpiece subdomain containing (F5Phe17)…
1YRF 1.07 Å, Chicken villin subdomain HP-35, N68H, pH6.7
5I1S 1.12 Å, Villin headpiece subdomain with a Lys30 to APC substitution
5I1N 1.3 Å, Villin headpiece subdomain with a Gln26 to beta-3-homoglutamine substitution
5I1O 1.35 Å, Villin headpiece subdomain with a Gln26 to ACPC substitution
1YU5 1.4 Å, Crystal Structure of the Headpiece Domain of Chicken Villin
2RJY 1.4 Å, Crystal structure of villin headpiece, P21 21 21 space group
5I1P 1.4 Å, Villin headpiece subdomain with a Lys30 to beta-3-homolysine substitution
1YU8 1.45 Å, Crystal Structure of the R37A Mutant of Villin Headpiece
2RJV 1.45 Å, Crystal structure of the H41Y mutant of villin headpiece, P 21 21 21 space group

Browse structure collections

About this viewer

MolViewer shows 2F4K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.