2RJY: Villin headpiece, P21 21 21 space group

Crystal structure of villin headpiece, P21 21 21 space group. Determined by X-ray diffraction at 1.4 Å resolution. Released 23 Sept 2008.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Gallus gallus
Chains: 1
Atoms: 596
Mol. weight: 7.61 kDa
Released: 23 Sept 2008

Explore 2RJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RJY contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	18-22	5
α-helix	26-28	3
α-helix	38-41	4
α-helix	44-51	8
α-helix	55-59	5
α-helix	63-72	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Villin-1	A	protein	67	Gallus gallus	P02640 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RJY_1 Villin-1 (chains A)
PTKLETFPLDVLVNTAAEDLPRGVDPSRKENHLSDEDFKAVFGMTRSAFANLPLWKQQNL
KKEKGLF

Primary citation

Crystal structure of a pH-stabilized mutant of villin headpiece. Meng, J., McKnight, C.J. Biochemistry (2008) 47:4644-4650. DOI 10.1021/bi7022738 · PubMed

Other PDB entries of the same protein (UniProt P02640 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WY3 0.95 Å, Chicken villin subdomain HP-35, K65(NLE), N68H, pH7.0
1YRI 1.0 Å, Chicken villin subdomain HP-35, N68H, pH6.4
3TRV 1.0 Å, Crystal structure of quasiracemic villin headpiece subdomain containing (F5Phe17)…
2F4K 1.05 Å, Chicken villin subdomain HP-35, K65(NLE), N68H, K70(NLE), PH9
1YRF 1.07 Å, Chicken villin subdomain HP-35, N68H, pH6.7
5I1S 1.12 Å, Villin headpiece subdomain with a Lys30 to APC substitution
5I1N 1.3 Å, Villin headpiece subdomain with a Gln26 to beta-3-homoglutamine substitution
5I1O 1.35 Å, Villin headpiece subdomain with a Gln26 to ACPC substitution
1YU5 1.4 Å, Crystal Structure of the Headpiece Domain of Chicken Villin
5I1P 1.4 Å, Villin headpiece subdomain with a Lys30 to beta-3-homolysine substitution
1YU8 1.45 Å, Crystal Structure of the R37A Mutant of Villin Headpiece
2RJV 1.45 Å, Crystal structure of the H41Y mutant of villin headpiece, P 21 21 21 space group

Browse structure collections

About this viewer

MolViewer shows 2RJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.