IgG1 FAB fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of HIV-1 GP120) (MN isolate). Determined by X-ray diffraction at 2.8 Å resolution. Released 9 Feb 1999.
Explore 2F58 in 3D Show helices and sheets RCSB PDB PDBe
2F58 contains 14 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 8 |
| β-strand | 11-12 | 2 | 9 |
| β-strand | 18-25 | 8 | 8 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 7 | 10 |
| β-strand | 45-52 | 8 | 10 |
| β-strand | 57-59 | 3 | 10 |
| α-helix | 61-64 | 4 | |
| β-strand | 67-72 | 6 | 8 |
| β-strand | 77-82 | 6 | 8 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-99 | 12 | 10 |
| β-strand | 100E-103 | 8 | 10 |
| β-strand | 107-109 | 3 | 10 |
| β-strand | 110-111 | 2 | 9 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 11 |
| β-strand | 120-124 | 5 | 12 |
| β-strand | 137-147 | 11 | 12 |
| β-strand | 148 | 1 | 11 |
| β-strand | 153-157 | 4 | 13 |
| α-helix | 162-164 | 3 | |
| β-strand | 171-173 | 3 | 12 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-178 | 2 | 12 |
| β-strand | 185-194 | 10 | 12 |
| β-strand | 205-212 | 7 | 13 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-223 | 7 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C-27D | 2 | 3 |
| β-strand | 30-31 | 2 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 93 | 1 | 4 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-105 | 4 | 2 |
| β-strand | 111 | 1 | 5 |
| β-strand | 114-118 | 5 | 6 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 6 |
| β-strand | 140 | 1 | 5 |
| β-strand | 144-150 | 7 | 7 |
| β-strand | 153-154 | 2 | 7 |
| β-strand | 159-163 | 5 | 6 |
| β-strand | 173-182 | 10 | 6 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 7 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 321 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (IgG1 FAB 58.2 antibody (light chain)) | L | protein | 216 | Mus musculus | P01666 (AlphaFold model) |
| Protein (IgG1 FAB 58.2 antibody (heavy chain)) | H | protein | 228 | Mus musculus | P18532 (AlphaFold model) |
| Protein (HIV-1 GP120) | P | protein | 11 |
>2F58_1 PROTEIN (IGG1 FAB 58.2 ANTIBODY (LIGHT CHAIN)) (chains L) DIVLTQSPASLAVSLGQRATISCKASQGVDFDGASFMNWYQQKPGQPPKLLIFAASTLES GIPARFSGRGSGTDFTLNIHPVEEEDAATYYCQQSHEDPLTFGAGTKLELKRADAAPTVS IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
>2F58_2 PROTEIN (IGG1 FAB 58.2 ANTIBODY (HEAVY CHAIN)) (chains H) DVQLQQSGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMGYIHYSAGTNY NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAREEAMPYGNQAYYYAMDCWGQGT TVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFP AVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
>2F58_3 PROTEIN (HIV-1 GP120) (chains P) HIGPGRAFGGG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ARN | 1-imino-5-pentanone | C5 H9 N O | 1 |
Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing fabs. Stanfield, R., Cabezas, E., Satterthwait, A. et al. Structure (1999) 7:131-142. DOI 10.1016/S0969-2126(99)80020-3 · PubMed
Other PDB entries of the same protein (UniProt P01666 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2F58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.