2F71: PDB entry 2F71

Protein tyrosine phosphatase 1B with sulfamic acid inhibitors. Determined by X-ray diffraction at 1.55 Å resolution. Released 13 Dec 2005.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,981
Mol. weight: 35.35 kDa
Ligands: MG, UN7
Released: 13 Dec 2005

Explore 2F71 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F71 contains 14 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	16-26	11
α-helix	38-43	6
α-helix	53-55	3
β-strand	56-58	3	1
α-helix	59	1
β-strand	66-74	9	1
β-strand	79-84	6	1
α-helix	85-88	4
α-helix	92-102	11
β-strand	106-109	4	1
β-strand	114-115	2	2
β-strand	118-119	2	2
β-strand	133-135	3	1
β-strand	140-149	10	1
β-strand	153-162	10	1
β-strand	167-176	10	1
α-helix	188-200	13
α-helix	209-210	2
β-strand	211-214	4	1
α-helix	220-238	19
α-helix	241-243	3
α-helix	246-253	8
α-helix	264-281	18
α-helix	287-295	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase, non-receptor type 1	A	protein	298	Homo sapiens	P18031 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2F71_1 Tyrosine-protein phosphatase, non-receptor type 1 (chains A)
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
UN7	3-[3-(3(S)-methylcarbamoyl-7-sulfoamino-3,4,-dihydro-1H-isoquinolin-2-yl)-3-oxo…	C21 H23 N3 O7 S	1

Water and common crystallization additives (CL) are not listed.

Primary citation

1,2,3,4-Tetrahydroisoquinolinyl sulfamic acids as phosphatase PTP1B inhibitors. Klopfenstein, S.R., Evdokimov, A.G., Colson, A.-O. et al. Bioorg Med Chem Lett (2006) 16:1574-1578. DOI 10.1016/j.bmcl.2005.12.051 · PubMed

Other PDB entries of the same protein (UniProt P18031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MN9 1.24 Å, PTP1B 1-284 F225Y-R199N
7MKZ 1.4 Å, PTP1B F225Y mutant, open state
9C66 1.4 Å, Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B
8U1E 1.43 Å, Apo protein tyrosine phosphatase 1B (PTP1B) at high resolution (1.43 A) in space group…
8G65 1.45 Å, Wildtype PTP1b in complex with DES4799
7MNA 1.47 Å, PTP1B 1-284 F225Y-R199N in complex with TCS401
7MOU 1.48 Å, PTP1B F225Y-R199N-L195R
2CM2 1.5 Å, Structure of Protein Tyrosine Phosphatase 1B (P212121)
7GTW 1.51 Å, PanDDA analysis group deposition of ground-state model of PTP1B, using pre-clustering,…
7GTX 1.51 Å, PanDDA analysis group deposition of ground-state model of PTP1B, using pre-clustering,…
5QGF 1.51 Å, PanDDA analysis group deposition -- Crystal structure of PTP1B in complex with…
7GU5 1.52 Å, PanDDA analysis group deposition of ground-state model of PTP1B, using pre-clustering,…

Browse structure collections

About this viewer

MolViewer shows 2F71 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.