2FL5: Immunoglobulin Igg1 Lambda Light Chain

Cofactor-containing antibodies: Crystal structure of the original yellow antibody. Determined by X-ray diffraction at 3.0 Å resolution. Released 21 Feb 2006.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 8
Atoms: 13,232
Mol. weight: 185.96 kDa
Ligands: RBF
Released: 21 Feb 2006

Explore 2FL5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FL5 contains 51 α-helices and 192 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	13
β-strand	5	1	14
β-strand	9-12	3	15
β-strand	19-24	6	14
β-strand	34-38	5	15
β-strand	45-48	4	15
β-strand	49	1	16
β-strand	53	1	16
β-strand	62-67	6	14
β-strand	70-75	6	14
α-helix	80-82	3
β-strand	85-91	7	15
β-strand	96-98	3	15
β-strand	99	1	13
β-strand	102-105	4	15
β-strand	111	1	17
β-strand	114-118	5	18
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-139	10	18
β-strand	140	1	17
β-strand	145-150	6	19
β-strand	153-155	3	19
β-strand	159-161	3	18
β-strand	165-166	2	18
β-strand	173-181	9	18
α-helix	183-188	6
β-strand	192-198	7	19
β-strand	203-209	7	19

Chain B: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	20
β-strand	11-12	2	21
β-strand	18-25	8	20
α-helix	29-31	3
β-strand	33-39	7	22
β-strand	46-51	6	22
β-strand	57-59	3	22
β-strand	64	1	23
β-strand	67	1	23
β-strand	68-72	5	20
β-strand	77-82	6	20
α-helix	84-86	3
β-strand	88-95	8	22
α-helix	96	1
β-strand	100C-103	4	22
β-strand	107-109	3	22
β-strand	110-111	2	21
β-strand	120-124	5	24
α-helix	130-134	3
β-strand	139-147	9	24
β-strand	153	1	25
β-strand	157	1	25
β-strand	166	1	25
β-strand	171-173	3	24
α-helix	174-176	3
β-strand	177-178	2	24
β-strand	185-192	8	24
α-helix	197-199	3
β-strand	207-212	6	25
α-helix	213-215	3
β-strand	217-222	6	25

Chain C: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	26
β-strand	5	1	27
β-strand	9-12	3	28
β-strand	19-24	6	27
α-helix	28-30	3
β-strand	34-38	5	28
β-strand	45-48	4	28
β-strand	49	1	29
β-strand	53	1	29
β-strand	62-67	6	27
β-strand	70-75	6	27
α-helix	80-82	3
β-strand	84-91	8	28
β-strand	96-98	3	28
β-strand	99	1	26
β-strand	102-105	4	28
β-strand	111	1	30
α-helix	112-113	2
β-strand	114-118	5	31
α-helix	119-121	3
α-helix	122-125	4
β-strand	130-139	10	31
β-strand	140	1	30
β-strand	145-150	6	32
β-strand	153-154	2	32
β-strand	159-161	3	31
α-helix	162-164	3
β-strand	165-166	2	31
β-strand	173-181	9	31
α-helix	183-188	6
β-strand	192-198	7	32
β-strand	203-209	7	32

Chain D: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	33
β-strand	11-12	2	34
β-strand	18-25	8	33
α-helix	29-31	3
β-strand	33-39	7	35
β-strand	46-51	6	35
β-strand	57-59	3	35
β-strand	64	1	36
β-strand	67	1	36
β-strand	68-72	5	33
α-helix	73-75	3
β-strand	77-82	6	33
α-helix	84-86	3
β-strand	88-95	8	35
α-helix	96	1
β-strand	100C-103	4	35
β-strand	107-109	3	35
β-strand	110-111	2	34
α-helix	117-119	3
β-strand	120-124	5	37
α-helix	130-134	3
β-strand	139-147	9	37
β-strand	153	1	38
β-strand	157	1	38
α-helix	162-164	3
β-strand	166	1	38
β-strand	171-173	3	37
α-helix	174-176	3
β-strand	177-178	2	37
β-strand	185-192	8	37
β-strand	206-212	7	38
α-helix	213-215	3
β-strand	217-225	7	38

Chain E: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	39
β-strand	5	1	40
β-strand	9-12	3	41
β-strand	19-24	6	40
β-strand	34-38	5	41
β-strand	45-48	4	41
β-strand	49	1	42
β-strand	53	1	42
β-strand	62-67	6	40
β-strand	70-75	6	40
α-helix	80-82	3
β-strand	85-91	7	41
β-strand	96-98	3	41
β-strand	99	1	39
β-strand	102-105	4	41
α-helix	111-113	3
β-strand	114-118	5	43
α-helix	119-121	3
α-helix	122-125	4
β-strand	130-139	10	43
β-strand	145-150	6	44
β-strand	153-155	3	44
β-strand	159-161	3	43
β-strand	165-166	2	43
β-strand	173-181	9	43
α-helix	183-188	6
β-strand	192-198	7	44
β-strand	203-209	7	44

Chain F: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	45
β-strand	11-12	2	46
β-strand	18-25	8	45
α-helix	29-31	3
β-strand	33-39	7	47
β-strand	46-51	6	47
β-strand	57-59	3	47
β-strand	64	1	48
β-strand	67	1	48
β-strand	68-72	5	45
α-helix	73-75	3
β-strand	77-82	6	45
α-helix	84-86	3
β-strand	88-95	8	47
β-strand	100C-103	4	47
β-strand	107-109	3	47
β-strand	110-111	2	46
α-helix	117-119	3
β-strand	120-124	5	49
α-helix	130-134	3
β-strand	139-147	9	49
β-strand	153	1	50
β-strand	157	1	50
α-helix	162-164	3
β-strand	171-173	3	49
α-helix	174-176	3
β-strand	177-178	2	49
β-strand	185-192	8	49
β-strand	206-212	7	50
α-helix	213-215	3
β-strand	217-225	7	50

Chain H: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
α-helix	29-31	3
β-strand	33-39	7	10
β-strand	46-51	6	10
β-strand	57-59	3	10
β-strand	64	1	8
β-strand	67-72	6	8
α-helix	73-75	3
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-95	8	10
β-strand	100C-103	4	10
β-strand	107-109	3	10
β-strand	110-111	2	9
α-helix	117-119	3
β-strand	120-124	5	11
α-helix	130-134	3
β-strand	139-147	9	11
β-strand	153	1	12
β-strand	157	1	12
α-helix	162-164	3
β-strand	166	1	12
β-strand	171-173	3	11
α-helix	174-176	3
β-strand	177-178	2	11
β-strand	185-192	8	11
α-helix	197-199	3
β-strand	206-212	7	12
α-helix	213-215	3
β-strand	217-225	7	12

Chain L: 2 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	5	1	2
β-strand	9-12	3	3
β-strand	19-24	6	2
β-strand	34-38	5	3
β-strand	45-48	4	3
β-strand	49	1	4
β-strand	53	1	4
β-strand	62-67	6	2
β-strand	70-75	6	2
β-strand	84-91	8	3
β-strand	96-98	3	3
β-strand	99	1	1
β-strand	102-105	4	3
β-strand	111	1	5
β-strand	114-118	5	6
α-helix	122-126	5
β-strand	130-139	10	6
β-strand	140	1	5
β-strand	145-150	6	7
β-strand	153-155	3	7
β-strand	159-161	3	6
β-strand	165-166	2	6
β-strand	173-181	9	6
α-helix	183-188	6
β-strand	192-198	7	7
β-strand	203-209	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin Igg1 Lambda Light Chain	A, C, E, L	protein	209	Homo sapiens	P0DOY2 (AlphaFold model)
Immunoglobulin Igg1 Heavy chain	B, D, F, H	protein	220	Homo sapiens	P01861 (AlphaFold model)

Sequence of entity 1 (A, C, E, L), FASTA

>2FL5_1 Immunoglobulin Igg1 Lambda Light Chain (chains A, C, E, L)
SYELKQPPSVSVSPGQTARITCSGDVLPKKYAYWYQERSGQAPVLVVYEDSGRPSEIPER
FSGSSSGTKATLTISGAQVEDEADYYCYSDISNGYPLFGGGTKLSVGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVTVAWKADSSPIKAGVETTTPSKQSNNKYAASSYLSL
TPEQWKSHRSYSCQVTHEGSTVEKTVAPT

Sequence of entity 2 (B, D, F, H), FASTA

>2FL5_2 Immunoglobulin Igg1 Heavy chain (chains B, D, F, H)
EVQLVESGGGLVQPGESLKLSCTASGFSLSNYYMTWVRQAPGKGLEWVTNIRPDETEKFY
SDSVKGRFTVSRDNARNSLFNSMSLQRVEDTATYYCARVSDFGDYGPDFWGQGTLVSVTS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTKTYTCNVNHKPSNTKVDKKVEP

Ligands and cofactors

ID	Name	Formula	Copies
RBF	Riboflavin	C17 H20 N4 O6	4

Primary citation

Cofactor-containing antibodies: Crystal structure of the original yellow antibody. Zhu, X., Wentworth, P., Kyle, R.A. et al. Proc Natl Acad Sci U S A (2006) 103:3581-3585. DOI 10.1073/pnas.0600251103 · PubMed

Other PDB entries of the same protein (UniProt P0DOY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
4LLY 1.6 Å, Crystal structure of Pertuzumab Clambda Fab with variable and constant domain redesigns…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
4LLM 1.75 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
8ECV 1.81 Å, Bovine Fab 2F12
1AQK 1.84 Å, Three-dimensional structure of a human FAB with high affinity for tetanus toxoid
1JVK 1.94 Å, Three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal…
4LLW 1.95 Å, Crystal structure of Pertuzumab Clambda Fab with variable domain redesign (VRD2) at 1.95A
4EOW 1.97 Å, Crystal structure of a disease-associated anti-human GM-CSF autoantibody MB007
7FAB 2.0 Å, Crystal structure of human immunoglobulin fragment FAB new refined at 2.0 Å resolution

Browse structure collections

About this viewer

MolViewer shows 2FL5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.