2FV4: Yeast kinetochore Spc24/Spc25 globular domain

NMR solution structure of the yeast kinetochore Spc24/Spc25 globular domain. Determined by solution NMR. Released 13 Jun 2006.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,171
Mol. weight: 19.51 kDa
Released: 13 Jun 2006

Explore 2FV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FV4 contains 6 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	134-145	12
β-strand	147-152	6	1
α-helix	153	1
β-strand	158-163	6	1
β-strand	169-172	4	1
β-strand	184-185	2	1
α-helix	191-203	13
α-helix	206-220	15

Chain B: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	158-167	10
β-strand	170-173	4	2
β-strand	178-182	5	2
β-strand	189-193	5	2
α-helix	200-211	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region	A	protein	98	Saccharomyces cerevisiae	P40014 (AlphaFold model)
Hypothetical 24.6 kDa protein in ILV2-ADE17 intergenic region	B	protein	77	Saccharomyces cerevisiae	Q04477 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FV4_1 Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region (chains A)
GSHMAAQSGNDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGN
SHPALDPKSRATLEHVLTVQGDLAAFLVVARDMLLASL

Sequence of entity 2 (B), FASTA

>2FV4_2 Hypothetical 24.6 kDa protein in ILV2-ADE17 intergenic region (chains B)
MAKVIEPELEEQSAVTPEANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDN
NLSDFYKTKYIWERLGK

Primary citation

Structure of a central component of the yeast kinetochore: the spc24p/spc25p globular domain. Wei, R.R., Schnell, J.R., Larsen, N.A. et al. Structure (2006) 6:1003-1009. DOI 10.1016/j.str.2006.04.007 · PubMed

Other PDB entries of the same protein (UniProt P40014 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T6J 1.75 Å, Structure of the MIND Complex Shows a Regulatory Focus of Yeast Kinetochore Assembly
2FTX 1.9 Å, Crystal structure of the yeast kinetochore Spc24/Spc25 globular domain
4GEQ 2.01 Å, Crystal structure of the Spc24-Spc25/Cnn1 binding interface
7KDF 2.72 Å, Structure of Stu2 Bound to dwarf Ndc80c
5TCS 2.83 Å, Crystal structure of a Dwarf Ndc80 Tetramer
8V10 3.02 Å, Structure of a Saccharomyces cerevisiae Mps1 peptide bound to dwarf Ndc80 Complex
8V11 3.95 Å, Structure of a Saccharomyces cerevisiae Ipl1 peptide Bound to dwarf Ndc80 complex
9S4Q 4.9 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex lacking the…
9S5N 7.2 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex containing the…
5TD8 7.53 Å, Crystal structure of an Extended Dwarf Ndc80 Complex

Browse structure collections

About this viewer

MolViewer shows 2FV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.