2FXK: H2A histone family, member Y isoform 1

Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form A). Determined by X-ray diffraction at 2.54 Å resolution. Released 14 Feb 2006.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,853
Mol. weight: 44.55 kDa
Released: 14 Feb 2006

Explore 2FXK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FXK contains 13 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	184-190	7	1
α-helix	195	1
β-strand	196-201	6	1
α-helix	204-206	3
β-strand	211-215	5	1
α-helix	224-249	26
α-helix	252-253	2
β-strand	257-261	5	1
β-strand	269-273	5	1
α-helix	275-277	3
α-helix	283-300	18
β-strand	305-308	4	1
α-helix	320-337	18
β-strand	345-349	5	1
α-helix	353-365	13

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	184-191	8	2
β-strand	195-201	7	2
α-helix	204-206	3
β-strand	211-215	5	2
α-helix	224-249	26
β-strand	257-261	5	2
β-strand	269-273	5	2
α-helix	283-300	18
β-strand	305-308	4	2
α-helix	320-337	18
β-strand	345-349	5	2
α-helix	353-363	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H2A histone family, member Y isoform 1	A, B	protein	211	Homo sapiens	O75367 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FXK_1 H2A histone family, member Y isoform 1 (chains A, B)
GAMQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNT
DFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVW
GADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVST
MSSSIKTVYFVLFDSESIGIYVQEMAKLDAN

Primary citation

Splicing regulates NAD metabolite binding to histone macroH2A. Kustatscher, G., Hothorn, M., Pugieux, C. et al. Nat Struct Mol Biol (2005) 12:624-625. DOI 10.1038/nsmb956 · PubMed

Other PDB entries of the same protein (UniProt O75367 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HSV 1.43 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
1ZR3 1.66 Å, Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form B)
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
3IID 1.9 Å, Crystal structure of the macro domain of human histone macroH2A1.1 in complex with…
3IIF 2.1 Å, Crystal structure of the macro domain of human histone macroH2A1.1 in complex with…
5IIT 2.13 Å, Structure of SPX domain of the yeast inorganic polyphophate polymerase Vtc4 crystallized…
3HQH 2.3 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
2F8N 2.9 Å, 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
9PM0 2.9 Å, nucleosome containing histone variant macroH2A
1ZR5 2.92 Å, Crystal structure of the macro-domain of human core histone variant macroH2A1.2
1U35 3.0 Å, Crystal structure of the nucleosome core particle containing the histone domain of…
7D3Y 3.11 Å, Crystal structure of the osPHR2-osSPX2 complex

Browse structure collections

About this viewer

MolViewer shows 2FXK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.