Crystal structure of the macro domain of human histone macroH2A1.1 in complex with ADP-ribose (form B). Determined by X-ray diffraction at 2.1 Å resolution. Released 18 Aug 2009.
Explore 3IIF in 3D Show helices and sheets RCSB PDB PDBe
3IIF contains 21 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 184-190 | 7 | 1 |
| β-strand | 196-201 | 6 | 1 |
| α-helix | 204-206 | 3 | |
| β-strand | 211-216 | 6 | 1 |
| α-helix | 225-249 | 25 | |
| α-helix | 252-253 | 2 | |
| β-strand | 257-261 | 5 | 1 |
| β-strand | 269-274 | 6 | 1 |
| α-helix | 275-277 | 3 | |
| α-helix | 283-300 | 18 | |
| β-strand | 305-309 | 5 | 1 |
| α-helix | 320-337 | 18 | |
| β-strand | 345-350 | 6 | 1 |
| α-helix | 353-361 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 184-190 | 7 | 1 |
| β-strand | 196-201 | 6 | 1 |
| α-helix | 204-206 | 3 | |
| β-strand | 211-216 | 6 | 1 |
| α-helix | 225-249 | 25 | |
| α-helix | 252-253 | 2 | |
| β-strand | 257-261 | 5 | 1 |
| β-strand | 269-274 | 6 | 1 |
| α-helix | 275-277 | 3 | |
| α-helix | 283-300 | 18 | |
| β-strand | 305-308 | 4 | 1 |
| α-helix | 320-334 | 15 | |
| β-strand | 345-350 | 6 | 1 |
| α-helix | 353-360 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 184-190 | 7 | 1 |
| β-strand | 196-201 | 6 | 1 |
| α-helix | 204-206 | 3 | |
| β-strand | 211-216 | 6 | 1 |
| α-helix | 225-249 | 25 | |
| α-helix | 252-253 | 2 | |
| β-strand | 257-261 | 5 | 1 |
| β-strand | 269-274 | 6 | 1 |
| α-helix | 275-277 | 3 | |
| α-helix | 283-300 | 18 | |
| β-strand | 305-308 | 4 | 1 |
| α-helix | 320-338 | 19 | |
| β-strand | 345-350 | 6 | 1 |
| α-helix | 353-360 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Core histone macro-H2A.1, Isoform 1 | A, B, C | protein | 211 | Homo sapiens | O75367 (AlphaFold model) |
>3IIF_1 Core histone macro-H2A.1, Isoform 1 (chains A, B, C) GAMQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNT DFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVW GADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVST MSSSIKTVYFVLFDSESIGIYVQEMAKLDAN
| ID | Name | Formula | Copies |
|---|---|---|---|
| APR | Adenosine-5-diphosphoribose | C15 H23 N5 O14 P2 | 3 |
A macrodomain-containing histone rearranges chromatin upon sensing PARP1 activation. Timinszky, G., Till, S., Hassa, P.O. et al. Nat Struct Mol Biol (2009) 16:923-929. DOI 10.1038/nsmb.1664 · PubMed
Other PDB entries of the same protein (UniProt O75367 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3IIF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.