Ketopiperazine-Based Renin Inhibitors: Optimization of the "C" Ring. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Jun 2006.
Explore 2G26 in 3D Show helices and sheets RCSB PDB PDBe
2G26 contains 29 α-helices and 63 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 8-10 | 3 | 2 |
| β-strand | 14-16 | 3 | 2 |
| β-strand | 17-21 | 5 | 3 |
| β-strand | 26-33 | 8 | 3 |
| β-strand | 39-42 | 4 | 3 |
| β-strand | 43 | 1 | 4 |
| α-helix | 51-54 | 4 | |
| β-strand | 59 | 1 | 4 |
| α-helix | 61-63 | 3 | |
| β-strand | 68-78 | 11 | 3 |
| β-strand | 81-94 | 14 | 3 |
| β-strand | 97-108 | 12 | 3 |
| α-helix | 111-114 | 4 | |
| β-strand | 121-124 | 4 | 3 |
| α-helix | 128-130 | 3 | |
| α-helix | 132-134 | 3 | |
| α-helix | 135-137 | 3 | |
| α-helix | 138-143 | 6 | |
| β-strand | 152-157 | 6 | 1 |
| β-strand | 167-171 | 5 | 1 |
| α-helix | 176-178 | 3 | |
| β-strand | 179-187 | 9 | 1 |
| β-strand | 195-198 | 4 | 5 |
| β-strand | 200-203 | 4 | 6 |
| β-strand | 209 | 1 | 6 |
| β-strand | 214-218 | 5 | 5 |
| β-strand | 225-227 | 3 | 5 |
| α-helix | 229-239 | 11 | |
| α-helix | 241 | 1 | |
| β-strand | 242-243 | 2 | 7 |
| β-strand | 248-251 | 4 | 7 |
| α-helix | 252-257 | 6 | |
| α-helix | 258-260 | 3 | |
| β-strand | 261-265 | 5 | 6 |
| β-strand | 268-272 | 5 | 6 |
| α-helix | 274-277 | 4 | |
| β-strand | 278 | 1 | 8 |
| β-strand | 288-290 | 3 | 7 |
| β-strand | 291 | 1 | 8 |
| β-strand | 293-295 | 3 | 5 |
| α-helix | 298-299 | 2 | |
| β-strand | 306-308 | 3 | 5 |
| α-helix | 310-313 | 4 | |
| β-strand | 316-321 | 6 | 1 |
| β-strand | 326-332 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 9 |
| β-strand | 14-21 | 8 | 9 |
| β-strand | 26-33 | 8 | 9 |
| β-strand | 39-42 | 4 | 9 |
| β-strand | 43 | 1 | 10 |
| α-helix | 51-53 | 3 | |
| β-strand | 59 | 1 | 10 |
| α-helix | 61-63 | 3 | |
| β-strand | 68 | 1 | 9 |
| β-strand | 73-76 | 4 | 9 |
| β-strand | 83-94 | 12 | 9 |
| β-strand | 97-108 | 12 | 9 |
| α-helix | 114-116 | 3 | |
| β-strand | 121-124 | 4 | 9 |
| α-helix | 128-130 | 3 | |
| α-helix | 132-134 | 3 | |
| α-helix | 135-137 | 3 | |
| α-helix | 138-144 | 7 | |
| β-strand | 152-157 | 6 | 9 |
| α-helix | 158-160 | 3 | |
| β-strand | 167-171 | 5 | 9 |
| α-helix | 176-178 | 3 | |
| β-strand | 179 | 1 | 11 |
| β-strand | 184-187 | 4 | 9 |
| β-strand | 188 | 1 | 12 |
| β-strand | 195-198 | 4 | 12 |
| β-strand | 201-203 | 3 | 13 |
| β-strand | 209 | 1 | 13 |
| β-strand | 214-218 | 5 | 12 |
| β-strand | 225-227 | 3 | 12 |
| α-helix | 229-239 | 11 | |
| β-strand | 242-243 | 2 | 14 |
| β-strand | 248-251 | 4 | 14 |
| α-helix | 255-257 | 3 | |
| α-helix | 259-260 | 2 | |
| β-strand | 261-265 | 5 | 13 |
| β-strand | 268-272 | 5 | 13 |
| α-helix | 274-277 | 4 | |
| β-strand | 278-279 | 2 | 14 |
| β-strand | 288-291 | 4 | 14 |
| β-strand | 293-295 | 3 | 12 |
| β-strand | 306-308 | 3 | 12 |
| α-helix | 310-315 | 6 | |
| β-strand | 316-321 | 6 | 9 |
| β-strand | 326-331 | 6 | 9 |
| β-strand | 332 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Renin | A, B | protein | 333 | Homo sapiens | P00797 (AlphaFold model) |
>2G26_1 Renin (chains A, B) SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDAS DSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGV VGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYE GNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALG AKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPP PTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
| ID | Name | Formula | Copies |
|---|---|---|---|
| 3LG | (5-{[(2R)-1-(4-{3-[(2-methoxybenzyl)oxy]propoxy}phenyl)-6-oxopiperazin-2-yl]met… | C32 H35 N3 O7 | 1 |
Ketopiperazine-Based Renin Inhibitors: Optimization of the "C" Ring. Holsworth, D.D., Cai, C., Cheng, X.M. et al. Bioorg Med Chem Lett (2006) 16:2500-2504. DOI 10.1016/j.bmcl.2006.01.084 · PubMed
Other PDB entries of the same protein (UniProt P00797 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2G26 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.