2G60: Anti-FLAG M2 Fab domain

Structure of anti-FLAG M2 Fab domain. Determined by X-ray diffraction at 1.85 Å resolution. Released 12 Sept 2006.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,518
Mol. weight: 45.63 kDa
Released: 12 Sept 2006

Explore 2G60 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G60 contains 15 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	7
β-strand	9-12	4	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	33-39	7	8
β-strand	45-51	7	8
β-strand	57-59	3	8
β-strand	67-72	6	7
α-helix	73-75	3
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-95	8	8
β-strand	100-103	4	8
β-strand	107-111	5	8
α-helix	115-116	2
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
β-strand	138-147	10	10
β-strand	148	1	9
β-strand	153-157	4	11
α-helix	162-164	3
β-strand	166	1	11
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-179	3	10
β-strand	184-193	10	10
β-strand	206-212	6	11
α-helix	213-215	3
β-strand	217-222	6	11

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-154	2	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-187	5
β-strand	192-197	6	6
β-strand	207	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
anti-FLAG M2 Fab light chain	L	protein	216	Mus musculus	Q65ZC0 (AlphaFold model)
anti-FLAG M2 Fab heavy chain	H	protein	215	Mus musculus	Q5BJZ2 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>2G60_1 anti-FLAG M2 Fab light chain (chains L)
DVLMTQAPLTLPVSLGDQASISCRSSQAIVHANGNTYLEWYLQKPGQSPALLIYKVANRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGAHAPYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (H), FASTA

>2G60_2 anti-FLAG M2 Fab heavy chain (chains H)
EVQLQQSGGELAKPGASVKMSCKSSGYTFTAYAIHWAKQAAGAGLEWIGYIAPAAGAAAY
NAAFKGKATLAADKSSSTAYMAAAALTSEDSAVYYCARAAAAGADYWGQGTTLTVSSAKT
TPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYT
LSSSVTVTSSPRPSETVTCNVAHPASSTKVDKKIV

Primary citation

Structure of anti-FLAG M2 Fab domain and its use in the stabilization of engineered membrane proteins. Roosild, T.P., Castronovo, S., Choe, S. Acta Crystallogr Sect F Struct Biol Cryst Commun (2006) 62:835-839. DOI 10.1107/S1744309106029125 · PubMed

Other PDB entries of the same protein (UniProt Q65ZC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LO2 2.0 Å, Retro-Diels-Alderase Catalytic Antibody
1L7T 2.1 Å, Crystal Structure Analysis of the anti-testosterone Fab fragment
1LO3 2.3 Å, Retro-Diels-Alderase Catalytic Antibody: Product Analogue
1T66 2.3 Å, The structure of FAB with intermediate affinity for fluorescein.
1LO4 2.4 Å, Retro-Diels-Alderase Catalytic antibody 9D9
2GK0 2.45 Å, Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2
1I9J 2.6 Å, Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone…
2GJZ 2.65 Å, Structure of Catalytic Elimination Antibody 13G5 from a crystal in space group P2(1)
1I9I 2.72 Å, Native crystal structure of the recombinant monoclonal wild type anti-testosterone FAB…

Browse structure collections

About this viewer

MolViewer shows 2G60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.