2GJZ: Catalytic elimination antibody 13G5 light chain

Structure of Catalytic Elimination Antibody 13G5 from a crystal in space group P2(1). Determined by X-ray diffraction at 2.65 Å resolution. Released 6 Feb 2007.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,706
Mol. weight: 95.56 kDa
Ligands: ZN
Released: 6 Feb 2007

Explore 2GJZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GJZ contains 25 α-helices and 86 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	27C	1	14
β-strand	31	1	14
β-strand	33-38	6	13
β-strand	45-48	4	13
α-helix	53	1
β-strand	54	1	13
α-helix	55	1
β-strand	62-66	5	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	85-90	6	13
β-strand	97-98	2	13
β-strand	102-106	5	13
β-strand	111	1	15
α-helix	112-113	2
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	16
β-strand	140	1	15
β-strand	145-150	6	17
β-strand	153-155	3	17
β-strand	159-163	5	16
α-helix	164-167	4
β-strand	173-182	10	16
α-helix	183-187	5
β-strand	191-198	8	17
β-strand	201-210	10	17

Chains B and H: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	18
β-strand	11-12	2	19
β-strand	18-25	8	18
β-strand	34-39	6	20
β-strand	46-51	6	20
β-strand	57-59	3	20
β-strand	67-72	6	18
β-strand	77-82	6	18
α-helix	84-86	3
β-strand	88-95	8	20
β-strand	100E-103	4	20
β-strand	107-109	3	20
β-strand	110-111	2	19
β-strand	117	1	21
α-helix	118-119	2
β-strand	120-124	5	22
β-strand	137-147	11	22
β-strand	148	1	21
β-strand	153-157	4	23
α-helix	162-164	3
β-strand	171-179	9	22
β-strand	184-194	11	22
β-strand	206-212	6	23
α-helix	213-215	3
β-strand	217-222	6	23

Chain L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-48	4	2
α-helix	53	1
β-strand	54	1	2
α-helix	55	1
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-187	5
β-strand	191-198	8	5
β-strand	201-210	10	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catalytic elimination antibody 13G5 light chain	A, L	protein	217	Mus musculus	Q65ZC0 (AlphaFold model)
Catalytic elimination antibody 13G5 heavy chain	B, H	protein	221	Mus musculus	P01867 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>2GJZ_1 Catalytic elimination antibody 13G5 light chain (chains A, L)
ELVMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKINRVEAEDLGVYYCFQGSHLPPTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Sequence of entity 2 (B, H), FASTA

>2GJZ_2 Catalytic elimination antibody 13G5 heavy chain (chains B, H)
QVQLKESGPGLVAPSQSLSITCTVSGFSLTNYGVDWVRQPPGKGLEWVGVIWSGGSTNYN
SALMSRLSISKDNSKSQVFLKMNSLQTDDTAVYYCAKHWGGYYIPYGMDHWGQGTTVTVS
SAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSSVHTFPALLQS
GLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	11

Primary citation

Bifunctional Catalysis of Proton Transfer at an Antibody Active Site. Muller, R., Debler, E.W., Steinmann, M. et al. J Am Chem Soc (2007) 129:460-461. DOI 10.1021/ja066578b · PubMed

Other PDB entries of the same protein (UniProt Q65ZC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2G60 1.85 Å, Structure of anti-FLAG M2 Fab domain
1LO2 2.0 Å, Retro-Diels-Alderase Catalytic Antibody
1L7T 2.1 Å, Crystal Structure Analysis of the anti-testosterone Fab fragment
1LO3 2.3 Å, Retro-Diels-Alderase Catalytic Antibody: Product Analogue
1T66 2.3 Å, The structure of FAB with intermediate affinity for fluorescein.
1LO4 2.4 Å, Retro-Diels-Alderase Catalytic antibody 9D9
2GK0 2.45 Å, Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2
1I9J 2.6 Å, Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone…
1I9I 2.72 Å, Native crystal structure of the recombinant monoclonal wild type anti-testosterone FAB…

Browse structure collections

About this viewer

MolViewer shows 2GJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.