Structure of anti-FLAG M2 Fab domain. Determined by X-ray diffraction at 1.85 Å resolution. Released 12 Sept 2006.
Explore 2G60 in 3D Show helices and sheets RCSB PDB PDBe
2G60 contains 15 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 7 |
| β-strand | 9-12 | 4 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 45-51 | 7 | 8 |
| β-strand | 57-59 | 3 | 8 |
| β-strand | 67-72 | 6 | 7 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 8 |
| β-strand | 100-103 | 4 | 8 |
| β-strand | 107-111 | 5 | 8 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 9 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 10 |
| β-strand | 138-147 | 10 | 10 |
| β-strand | 148 | 1 | 9 |
| β-strand | 153-157 | 4 | 11 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 11 |
| β-strand | 171-173 | 3 | 10 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 10 |
| β-strand | 184-193 | 10 | 10 |
| β-strand | 206-212 | 6 | 11 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 4 |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-127 | 6 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 145-150 | 6 | 6 |
| β-strand | 153-154 | 2 | 6 |
| β-strand | 159-163 | 5 | 5 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-187 | 5 | |
| β-strand | 192-197 | 6 | 6 |
| β-strand | 207 | 1 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| anti-FLAG M2 Fab light chain | L | protein | 216 | Mus musculus | Q65ZC0 (AlphaFold model) |
| anti-FLAG M2 Fab heavy chain | H | protein | 215 | Mus musculus | Q5BJZ2 (AlphaFold model) |
>2G60_1 anti-FLAG M2 Fab light chain (chains L) DVLMTQAPLTLPVSLGDQASISCRSSQAIVHANGNTYLEWYLQKPGQSPALLIYKVANRF SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGAHAPYTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
>2G60_2 anti-FLAG M2 Fab heavy chain (chains H) EVQLQQSGGELAKPGASVKMSCKSSGYTFTAYAIHWAKQAAGAGLEWIGYIAPAAGAAAY NAAFKGKATLAADKSSSTAYMAAAALTSEDSAVYYCARAAAAGADYWGQGTTLTVSSAKT TPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYT LSSSVTVTSSPRPSETVTCNVAHPASSTKVDKKIV
Structure of anti-FLAG M2 Fab domain and its use in the stabilization of engineered membrane proteins. Roosild, T.P., Castronovo, S., Choe, S. Acta Crystallogr Sect F Struct Biol Cryst Commun (2006) 62:835-839. DOI 10.1107/S1744309106029125 · PubMed
Other PDB entries of the same protein (UniProt Q65ZC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2G60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.