Structure of the Light Chain of Botulinum Neurotoxin Serotype A Bound to small Molecule Inhibitors. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Mar 2007.
Explore 2G7N in 3D Show helices and sheets RCSB PDB PDBe
2G7N contains 20 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-13 | 2 | |
| β-strand | 18-22 | 5 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 41-47 | 7 | 1 |
| β-strand | 72 | 1 | 2 |
| α-helix | 80-98 | 19 | |
| α-helix | 101-112 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 118 | 1 | 3 |
| β-strand | 125-126 | 2 | 4 |
| β-strand | 127 | 1 | 3 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-137 | 5 | 1 |
| α-helix | 138 | 1 | |
| β-strand | 143-147 | 5 | 1 |
| β-strand | 150-154 | 5 | 1 |
| β-strand | 158 | 1 | 2 |
| β-strand | 163-165 | 3 | 1 |
| β-strand | 183-186 | 4 | 1 |
| β-strand | 191-195 | 5 | 5 |
| α-helix | 199-202 | 4 | |
| β-strand | 212-213 | 2 | 5 |
| α-helix | 214-215 | 2 | |
| α-helix | 216-231 | 16 | |
| α-helix | 235-237 | 3 | |
| β-strand | 241-242 | 2 | 6 |
| α-helix | 248-253 | 6 | |
| β-strand | 257-258 | 2 | 6 |
| α-helix | 259-265 | 7 | |
| α-helix | 267-270 | 4 | |
| α-helix | 275-298 | 24 | |
| β-strand | 301-302 | 2 | 4 |
| α-helix | 309-320 | 12 | |
| β-strand | 323-324 | 2 | 7 |
| β-strand | 330-331 | 2 | 7 |
| α-helix | 334-342 | 9 | |
| α-helix | 343-347 | 5 | |
| α-helix | 350-357 | 8 | |
| β-strand | 371-374 | 4 | 5 |
| β-strand | 384 | 1 | 8 |
| β-strand | 388 | 1 | 8 |
| α-helix | 401-403 | 3 | |
| β-strand | 404 | 1 | 5 |
| α-helix | 409-411 | 3 | |
| β-strand | 413-417 | 5 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Botulinum neurotoxin type A | A | protein | 425 | Clostridium botulinum | Q45894 (AlphaFold model) |
>2G7N_1 Botulinum neurotoxin type A (chains A) MFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNP PPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGS TIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHDVLNLTRNGYG STQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAEHRLYGIAINPNR VFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKAK SIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKVI NRKTYLNFDKAVFRINIVPDENYTIKDGFNLKGANLSTNFNGQNTEINSRNFTRLKNFTG LFEFY
Structure of the Light Chain of Botulinum Neurotoxin Serotype A bound to Small Molecule Inhibitors. Fu, Z., Baldwin, M.R., Boldt, G.E. et al. To be published.
Other PDB entries of the same protein (UniProt Q45894 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2G7N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.