Structure of the Light Chain of Botulinum Neurotoxin Serotype A Bound to Small Molecule Inhibitors. Determined by X-ray diffraction at 2.41 Å resolution. Released 15 Aug 2006.
Explore 2G7Q in 3D Show helices and sheets RCSB PDB PDBe
2G7Q contains 34 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-13 | 2 | |
| β-strand | 18-22 | 5 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 41-47 | 7 | 1 |
| α-helix | 53-55 | 3 | |
| β-strand | 72 | 1 | 2 |
| α-helix | 80-99 | 20 | |
| α-helix | 101-112 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 118 | 1 | 3 |
| β-strand | 125-126 | 2 | 4 |
| β-strand | 127 | 1 | 3 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-137 | 5 | 1 |
| β-strand | 143-147 | 5 | 1 |
| β-strand | 150-154 | 5 | 1 |
| β-strand | 158 | 1 | 2 |
| β-strand | 163-165 | 3 | 1 |
| β-strand | 183-186 | 4 | 1 |
| β-strand | 191-195 | 5 | 5 |
| β-strand | 203 | 1 | 6 |
| β-strand | 212-213 | 2 | 5 |
| α-helix | 216-231 | 16 | |
| β-strand | 241-244 | 4 | 7 |
| β-strand | 255-258 | 4 | 7 |
| α-helix | 259-265 | 7 | |
| α-helix | 267-270 | 4 | |
| α-helix | 275-298 | 24 | |
| β-strand | 301-302 | 2 | 4 |
| α-helix | 309-320 | 12 | |
| β-strand | 323-324 | 2 | 8 |
| β-strand | 330-331 | 2 | 8 |
| α-helix | 334-342 | 9 | |
| α-helix | 343-347 | 5 | |
| α-helix | 350-357 | 8 | |
| β-strand | 371-374 | 4 | 5 |
| β-strand | 384 | 1 | 9 |
| β-strand | 388 | 1 | 9 |
| α-helix | 401-403 | 3 | |
| β-strand | 404 | 1 | 5 |
| α-helix | 409-411 | 3 | |
| β-strand | 413-416 | 4 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-13 | 2 | |
| β-strand | 18-21 | 4 | 10 |
| β-strand | 22 | 1 | 11 |
| β-strand | 32-38 | 7 | 10 |
| β-strand | 41-47 | 7 | 10 |
| α-helix | 59-61 | 3 | |
| β-strand | 72 | 1 | 12 |
| α-helix | 80-98 | 19 | |
| α-helix | 101-112 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 118 | 1 | 13 |
| β-strand | 125-127 | 3 | 13 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-137 | 5 | 11 |
| β-strand | 143-147 | 5 | 11 |
| β-strand | 150-154 | 5 | 10 |
| β-strand | 158 | 1 | 12 |
| β-strand | 163-165 | 3 | 10 |
| β-strand | 183-186 | 4 | 10 |
| β-strand | 191-196 | 6 | 14 |
| β-strand | 203 | 1 | 6 |
| β-strand | 211-213 | 3 | 14 |
| α-helix | 214-215 | 2 | |
| α-helix | 216-231 | 16 | |
| β-strand | 241-245 | 5 | 15 |
| β-strand | 254-258 | 5 | 15 |
| α-helix | 259-265 | 7 | |
| α-helix | 267-270 | 4 | |
| α-helix | 275-297 | 23 | |
| β-strand | 301-303 | 3 | 13 |
| α-helix | 309-319 | 11 | |
| β-strand | 323-324 | 2 | 16 |
| β-strand | 330-331 | 2 | 16 |
| α-helix | 334-342 | 9 | |
| α-helix | 343-347 | 5 | |
| α-helix | 350-357 | 8 | |
| β-strand | 371-374 | 4 | 14 |
| β-strand | 384 | 1 | 17 |
| β-strand | 388 | 1 | 17 |
| α-helix | 401-403 | 3 | |
| β-strand | 404 | 1 | 14 |
| α-helix | 409-411 | 3 | |
| β-strand | 413-416 | 4 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Botulinum neurotoxin type A | A, B | protein | 425 | Clostridium botulinum | Q45894 (AlphaFold model) |
>2G7Q_1 Botulinum neurotoxin type A (chains A, B) MFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNP PPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGS TIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHDVLNLTRNGYG STQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAEHRLYGIAINPNR VFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKAK SIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKVI NAKTFLNFDKAVFRINIVPDENYTIKDGFNLKGANLSTNFNGQNTEINSRNFTRLKNFTG LFEFY
Light chain of botulinum neurotoxin serotype A: structural resolution of a catalytic intermediate. Fu, Z., Chen, S., Baldwin, M.R. et al. Biochemistry (2006) 45:8903-8911. DOI 10.1021/bi060786z · PubMed
Other PDB entries of the same protein (UniProt Q45894 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2G7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.