2GBJ: 9-10 8 Glycine Insertion Mutant of Ubiquitin

Crystal Structure of the 9-10 8 Glycine Insertion Mutant of Ubiquitin. Determined by X-ray diffraction at 1.35 Å resolution. Released 16 May 2006.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,410
Mol. weight: 18.07 kDa
Released: 16 May 2006

Explore 2GBJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GBJ contains 9 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	20-24	5	1
β-strand	30	1	2
α-helix	31-42	12
α-helix	46-48	3
β-strand	49-53	5	1
β-strand	56-57	2	1
α-helix	58-59	2
β-strand	63	1	2
α-helix	65-67	3
β-strand	74-79	6	1

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	3
α-helix	8-9	2
β-strand	20-24	5	3
β-strand	30	1	4
α-helix	31-42	12
α-helix	46-48	3
β-strand	49-53	5	3
β-strand	56-57	2	3
α-helix	58-59	2
β-strand	63	1	4
α-helix	65-67	3
β-strand	74-79	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin	A, B	protein	84	Homo sapiens	P0CG48 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2GBJ_1 Ubiquitin (chains A, B)
MQIFVKTLTGGGGGGGGGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGG

Primary citation

Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis. Ferraro, D.M., Ferraro, D.J., Ramaswamy, S. et al. J Mol Biol (2006) 359:390-402. DOI 10.1016/j.jmb.2006.03.047 · PubMed

Other PDB entries of the same protein (UniProt P0CG48 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q00 0.85 Å, TDP2 UBA Domain Bound to Ubiquitin at 0.85 Angstroms Resolution, Crystal Form 1
1OGW 1.32 Å, Synthetic Ubiquitin with fluoro-Leu at 50 and 67
5NL4 1.32 Å, Crystal structure of Zn1.3-E16V human ubiquitin (hUb) mutant adduct, from a solution 35…
4HK2 1.4 Å, U7Ub25.2540
9FJ3 1.4 Å, Structure of ubiquitin bound of coiled-coil UIM form 2
1XD3 1.45 Å, Crystal structure of UCHL3-UbVME complex
4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
7UV5 1.45 Å, The crystal structure of Papain-Like Protease of SARS CoV-2, C111S/D286N mutant, in…
5NLF 1.5 Å, Crystal structure of Zn2.7-E16V human ubiquitin (hUb) mutant adduct, from a solution 100…
9F6G 1.5 Å, Human USP30 chimera bound to Ubiquitin-PA
9OVX 1.5 Å, Crystal structure of ubiquitin K27M mutant
4UN2 1.51 Å, Crystal structure of the UBA domain of Dsk2 in complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 2GBJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.