4HK2: U7Ub25.2540

U7Ub25.2540. Determined by X-ray diffraction at 1.4 Å resolution. Released 21 Nov 2012.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,691
Mol. weight: 35.74 kDa
Released: 21 Nov 2012

Explore 4HK2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HK2 contains 18 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	1
β-strand	12-17	6	1
β-strand	22	1	2
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	2
α-helix	56-58	3
β-strand	66-71	6	1

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	3
β-strand	12-17	6	3
β-strand	22	1	4
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	3
β-strand	48-49	2	3
α-helix	50-51	2
β-strand	55	1	4
α-helix	56-59	4
β-strand	66-71	6	3

Chain C: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	1
β-strand	12-17	6	1
β-strand	22	1	5
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	5
α-helix	57-59	3
α-helix	61-62	2
β-strand	66-71	6	1

Chain D: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	12-17	6	1
β-strand	22	1	6
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	6
α-helix	56-59	4
α-helix	61-62	2
β-strand	66-71	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin	A, B, C, D	protein	78	Homo sapiens	P0CG48 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4HK2_1 Ubiquitin (chains A, B, C, D)
GSMQIFVKFRTGKTYTLEVEPSDTIENVKAKIQDKLGIPPDQQWLIFAGKRLEDGRTLSD
YNIQKESTLRGVRRLRGG

Primary citation

Potent and selective inhibitors of USP7/HAUSP activity by protein conformational stabilization. Zhang, Y., Zhou, L., Rouge, L. et al. To be published.

Other PDB entries of the same protein (UniProt P0CG48 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q00 0.85 Å, TDP2 UBA Domain Bound to Ubiquitin at 0.85 Angstroms Resolution, Crystal Form 1
1OGW 1.32 Å, Synthetic Ubiquitin with fluoro-Leu at 50 and 67
5NL4 1.32 Å, Crystal structure of Zn1.3-E16V human ubiquitin (hUb) mutant adduct, from a solution 35…
2GBJ 1.35 Å, Crystal Structure of the 9-10 8 Glycine Insertion Mutant of Ubiquitin.
9FJ3 1.4 Å, Structure of ubiquitin bound of coiled-coil UIM form 2
1XD3 1.45 Å, Crystal structure of UCHL3-UbVME complex
4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
7UV5 1.45 Å, The crystal structure of Papain-Like Protease of SARS CoV-2, C111S/D286N mutant, in…
5NLF 1.5 Å, Crystal structure of Zn2.7-E16V human ubiquitin (hUb) mutant adduct, from a solution 100…
9F6G 1.5 Å, Human USP30 chimera bound to Ubiquitin-PA
9OVX 1.5 Å, Crystal structure of ubiquitin K27M mutant
4UN2 1.51 Å, Crystal structure of the UBA domain of Dsk2 in complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 4HK2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.