2GI7: Human platelet Glycoprotein VI

Crystal structure of human platelet Glycoprotein VI (GPVI). Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Apr 2007.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,919
Mol. weight: 40.81 kDa
Released: 3 Apr 2007

Explore 2GI7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GI7 contains 12 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	4	1
β-strand	5	1	1
α-helix	6-8	3
β-strand	9-13	5	2
β-strand	17-19	3	3
β-strand	24-29	6	2
β-strand	36-41	6	4
β-strand	47-48	2	4
β-strand	52-55	4	2
α-helix	60-62	3
β-strand	64-72	9	4
β-strand	75-76	2	4
β-strand	77	1	1
α-helix	78-82	5
β-strand	83-85	3	4
β-strand	86-88	3	3
β-strand	95-99	5	5
α-helix	100-102	3
β-strand	110-115	6	5
β-strand	122-127	6	6
β-strand	139-143	5	6
β-strand	147-150	4	5
α-helix	153-154	2
β-strand	156-163	8	6
β-strand	170	1	3
α-helix	173-177	5
β-strand	178-181	4	6

Chain B: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	4	1
β-strand	5	1	7
α-helix	6-7	2
β-strand	9-13	5	8
β-strand	17-19	3	9
β-strand	24-29	6	8
β-strand	36-41	6	10
β-strand	46-48	3	10
β-strand	52-55	4	8
α-helix	60-62	3
β-strand	64-72	9	10
β-strand	75-76	2	10
β-strand	77	1	7
α-helix	78-82	5
β-strand	83-85	3	10
β-strand	86-88	3	9
β-strand	95-97	3	11
β-strand	110-115	6	11
β-strand	122-127	6	6
β-strand	140-143	4	6
β-strand	147-150	4	11
β-strand	156-163	8	6
β-strand	170	1	9
α-helix	173-177	5
β-strand	178-182	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GPVI protein	A, B	protein	184	Homo sapiens	Q9HCN6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2GI7_1 GPVI protein (chains A, B)
GQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMK
RSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYG
FDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLE
LVVT

Primary citation

Structural basis for platelet collagen responses by the immune-type receptor glycoprotein VI. Horii, K., Kahn, M.L., Herr, A.B. Blood (2006) 108:936-942. DOI 10.1182/blood-2006-01-010215 · PubMed

Other PDB entries of the same protein (UniProt Q9HCN6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OU7 1.9 Å, Crystal structure of the Glycoprotein VI loop truncation mutant PAVS-PAPYKN
7R58 1.9 Å, Crystal structure of the GPVI-glenzocimab complex
5OU8 2.5 Å, Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)5
5OU9 2.5 Å, Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)3
7NMU 2.5 Å, Crystal structure of human platelet glycoprotein VI in complex with an inhibitory…

Browse structure collections

About this viewer

MolViewer shows 2GI7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.