5OU9: Glycoprotein VI

Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)3. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Sept 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 5
Atoms: 3,203
Mol. weight: 45.78 kDa
Ligands: NAG
Released: 5 Sept 2018

Explore 5OU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OU9 contains 17 α-helices and 40 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
β-strand	9-13	5	1
β-strand	17-19	3	2
β-strand	20	1	3
β-strand	24-29	6	1
β-strand	36-41	6	4
β-strand	47-48	2	4
β-strand	52-55	4	1
β-strand	58	1	3
α-helix	60-62	3
β-strand	64-72	9	4
β-strand	75-76	2	4
α-helix	77-82	6
β-strand	83-85	3	4
β-strand	86-91	6	2
β-strand	95-101	7	5
β-strand	105-111	7	5
β-strand	118-123	6	6
β-strand	129-133	5	6
β-strand	137-140	4	5
α-helix	143-144	2
β-strand	146-153	8	6
β-strand	160	1	2
β-strand	161	1	6
β-strand	162	1	2
α-helix	163-167	5
β-strand	168-170	3	6

Chain B: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	9-13	5	7
β-strand	17-19	3	8
β-strand	24-29	6	7
β-strand	36-41	6	9
β-strand	46-48	3	9
β-strand	52-55	4	7
α-helix	60-62	3
β-strand	64-72	9	9
β-strand	75-76	2	9
α-helix	77-81	5
β-strand	83-85	3	9
β-strand	86-88	3	8
β-strand	95-100	6	10
β-strand	105-111	7	10
β-strand	118-123	6	11
β-strand	129-133	5	11
β-strand	137-141	5	10
β-strand	146-154	9	11
β-strand	157-161	5	11
α-helix	162-167	6
β-strand	168-170	3	11

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	11-13	3

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-6	5
α-helix	8-12	5
α-helix	14-19	6

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-6	5
α-helix	8-12	5
α-helix	14-18	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Platelet glycoprotein VI	A, B	protein	181	Homo sapiens	Q9HCN6 (AlphaFold model)
(GPO)3	C, D, E	protein	21	Homo sapiens	P02452 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5OU9_1 Platelet glycoprotein VI (chains A, B)
GSQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAM
KRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGSGGDVTLQCQTRYGFDQ
FALYKEGDPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSAA
A

Sequence of entity 2 (C, D, E), FASTA

>5OU9_2 (GPO)3 (chains C, D, E)
GPPGPPGPPGPPGPPGPPGPP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (PG4, CL) are not listed.

Primary citation

Structural insights into collagen-binding by platelet receptor Glycoprotein VI. Feitsma, L.J., Brondijk, T.H.C., Jarvis, G. et al. To be published.

Other PDB entries of the same protein (UniProt Q9HCN6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OU7 1.9 Å, Crystal structure of the Glycoprotein VI loop truncation mutant PAVS-PAPYKN
7R58 1.9 Å, Crystal structure of the GPVI-glenzocimab complex
2GI7 2.4 Å, Crystal structure of human platelet Glycoprotein VI (GPVI)
5OU8 2.5 Å, Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)5
7NMU 2.5 Å, Crystal structure of human platelet glycoprotein VI in complex with an inhibitory…

Browse structure collections

About this viewer

MolViewer shows 5OU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.