2GIB: Nucleocapsid protein

Crystal structure of the SARS coronavirus nucleocapsid protein dimerization domain. Determined by X-ray diffraction at 1.75 Å resolution. Released 25 Apr 2006.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: SARS coronavirus
Chains: 2
Atoms: 1,727
Mol. weight: 23.21 kDa
Released: 25 Apr 2006

Explore 2GIB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GIB contains 15 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	271-275	5
β-strand	287	1	1
α-helix	290-295	6
α-helix	296-298	3
α-helix	302-306	5
α-helix	310-311	2
α-helix	312-318	7
β-strand	320-325	6	2
β-strand	330-340	11	2
α-helix	347-357	11
β-strand	358	1	1
α-helix	360-363	4

Chain B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	287	1	3
α-helix	290-295	6
α-helix	296-298	3
α-helix	302-306	5
α-helix	310-311	2
α-helix	312-318	7
β-strand	320-326	7	2
β-strand	329-339	11	2
α-helix	347-357	11
β-strand	358	1	3
α-helix	360-363	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleocapsid protein	A, B	protein	103	SARS coronavirus	P59595 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2GIB_1 Nucleocapsid protein (chains A, B)
SANVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTP
SGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPK

Primary citation

Crystal structure of the severe acute respiratory syndrome (SARS) coronavirus nucleocapsid protein dimerization domain reveals evolutionary linkage between corona- and arteriviridae. Yu, I.M., Oldham, M.L., Zhang, J. et al. J Biol Chem (2006) 281:17134-17139. DOI 10.1074/jbc.M602107200 · PubMed

Other PDB entries of the same protein (UniProt P59595 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OFZ 1.17 Å, Ultrahigh Resolution Crystal Structure of RNA Binding Domain of SARS Nucleopcapsid (N…
1X7Q 1.45 Å, Crystal structure of HLA-A*1101 with sars nucleocapsid peptide
2OG3 1.85 Å, structure of the rna binding domain of n protein from SARS coronavirus in cubic crystal…
7LG0 2.3 Å, Human leukocyte antigen B*07:02 in complex with SARS-CoV2 epitope SPRWYFYYL
6IEX 2.31 Å, Crystal structure of HLA-B*4001 in complex with SARS-CoV derived peptide N216-225…
3I6L 2.4 Å, Newly identified epitope N1 derived from SARS-CoV N protein complexed with HLA-A*2402
2CJR 2.5 Å, Crystal structure of oligomerization domain of SARS coronavirus nucleocapsid protein.
1SSK Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein
2JW8 Solution structure of stereo-array isotope labelled (SAIL) C-terminal dimerization…

Browse structure collections

About this viewer

MolViewer shows 2GIB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.