2GKV: SGPB:P14'-Ala32 OMTKY3-del(1-5) complex

Crystal structure of the SGPB:P14'-Ala32 OMTKY3-del(1-5) complex. Determined by X-ray diffraction at 1.7 Å resolution. Released 13 Feb 2007.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Streptomyces griseus, Meleagris gallopavo
Chains: 3
Atoms: 2,200
Mol. weight: 29.85 kDa
Released: 13 Feb 2007

Explore 2GKV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GKV contains 4 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-17	2	3
β-strand	20	1	2
β-strand	23-25	3	4
β-strand	30-31	2	4
α-helix	34-43	10
β-strand	50-53	4	4

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	23-25	3	5
β-strand	30-31	2	5
α-helix	34-43	10
β-strand	50-53	4	5

Chain E: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	1
β-strand	30-32	3	2
β-strand	41-43	3	2
β-strand	46-48B	5	2
β-strand	49-54	6	2
α-helix	56-59	4
β-strand	65-67	3	2
β-strand	84-93	9	2
β-strand	100	1	3
β-strand	103-108	6	2
β-strand	118-119	2	1
β-strand	122-123	2	1
β-strand	126-127	2	3
β-strand	135-140	6	3
β-strand	156-170	15	3
β-strand	176-183	8	3
β-strand	198-201	4	3
β-strand	208-219	12	3
β-strand	223-230	8	3
α-helix	231-237	8
β-strand	240-241	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptogrisin B	E	protein	185	Streptomyces griseus	P00777 (AlphaFold model)
Ovomucoid	A, B	protein	51	Meleagris gallopavo	P68390 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>2GKV_1 Streptogrisin B (chains E)
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFP
NNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNY
GGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAY
GVSVY

Sequence of entity 2 (A, B), FASTA

>2GKV_2 Ovomucoid (chains A, B)
VDCSEYPKPACTLEYRPLCGSDNKTYANKCNFCNAVVESNGTLTLSHFGKC

Primary citation

Structural Insights into the Non-additivity Effects in the Sequence-to-Reactivity Algorithm for Serine Peptidases and their Inhibitors. Lee, T.W., Qasim, M.A., Laskowski, M. et al. J Mol Biol (2007) 367:527-546. DOI 10.1016/j.jmb.2007.01.008 · PubMed

Other PDB entries of the same protein (UniProt P00777 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QA9 1.18 Å, Crystal structure of the second tetrahedral intermediates of SGPB at pH 4.2
2QAA 1.23 Å, Crystal structure of the second tetrahedral intermediates of SGPB at pH 7.3
1SGP 1.4 Å, Ala 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1CT4 1.6 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-VAL18I in complex with sgpb
1CT2 1.65 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-THR18I in complex with sgpb
2NU2 1.65 Å, Accommodation of positively-charged residues in a hydrophobic specificity pocket:…
1DS2 1.7 Å, Crystal structure of SGPB:OMTKY3-coo-LEU18I
2NU4 1.75 Å, Accommodation of positively-charged residues in a hydrophobic specificity pocket:…
2SGF 1.75 Å, Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1CT0 1.8 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-SER18I in complex with sgpb
1SGD 1.8 Å, Asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1SGE 1.8 Å, Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…

Browse structure collections

About this viewer

MolViewer shows 2GKV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.