2QAA: Streptogrisin-B

Crystal structure of the second tetrahedral intermediates of SGPB at pH 7.3. Determined by X-ray diffraction at 1.23 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 1.23 Å
Organism: Streptomyces griseus
Chains: 2
Atoms: 3,397
Mol. weight: 39.8 kDa
Ligands: LEU, TYR
Released: 11 Dec 2007

Explore 2QAA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QAA contains 4 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	1
β-strand	30-32	3	2
β-strand	41-43	3	2
β-strand	46-48B	5	2
β-strand	49-54	6	2
α-helix	56-59	4
β-strand	65-67	3	2
β-strand	84-93	9	2
β-strand	100	1	3
β-strand	103-108	6	2
β-strand	118-119	2	1
β-strand	122-123	2	1
β-strand	126-127	2	3
β-strand	135-140	6	3
β-strand	156-170	15	3
β-strand	176-183	8	3
β-strand	198-201	4	3
β-strand	208-219	12	3
β-strand	223-230	8	3
α-helix	231-237	8
β-strand	240-241	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptogrisin-B	A, B	protein	185	Streptomyces griseus	P00777 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QAA_1 Streptogrisin-B (chains A, B)
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFP
NNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNY
GGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAY
GVSVY

Ligands and cofactors

ID	Name	Formula	Copies
LEU	Leucine	C6 H13 N O2	2
TYR	Tyrosine	C9 H11 N O3	2

Water and common crystallization additives (ACY, GOL, EPE, EDO, CL, SO4) are not listed.

Primary citation

1.2A-resolution crystal structures reveal the second tetrahedral intermediates of streptogrisin B (SGPB). Lee, T.W., James, M.N. Biochim Biophys Acta (2008) 1784:319-334. DOI 10.1016/j.bbapap.2007.11.012 · PubMed

Other PDB entries of the same protein (UniProt P00777 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QA9 1.18 Å, Crystal structure of the second tetrahedral intermediates of SGPB at pH 4.2
1SGP 1.4 Å, Ala 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1CT4 1.6 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-VAL18I in complex with sgpb
1CT2 1.65 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-THR18I in complex with sgpb
2NU2 1.65 Å, Accommodation of positively-charged residues in a hydrophobic specificity pocket:…
1DS2 1.7 Å, Crystal structure of SGPB:OMTKY3-coo-LEU18I
2GKV 1.7 Å, Crystal structure of the SGPB:P14'-Ala32 OMTKY3-del(1-5) complex
2NU4 1.75 Å, Accommodation of positively-charged residues in a hydrophobic specificity pocket:…
2SGF 1.75 Å, Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1CT0 1.8 Å, Crystal structure of the OMTKY3 P1 variant OMTKY3-SER18I in complex with sgpb
1SGD 1.8 Å, Asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…
1SGE 1.8 Å, Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces…

Browse structure collections

About this viewer

MolViewer shows 2QAA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.