2GKW: TNF receptor-associated factor 3

Key contacts promote recongnito of BAFF-R by TRAF3. Determined by X-ray diffraction at 2.7 Å resolution. Released 11 Apr 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,650
Mol. weight: 24.25 kDa
Released: 11 Apr 2006

Explore 2GKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GKW contains 7 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	314-346	33
β-strand	353-359	7	1
α-helix	361-370	10
β-strand	376-377	2	2
α-helix	378-380	3
β-strand	381-382	2	2
β-strand	389-395	7	2
α-helix	400-402	3
β-strand	406-414	9	2
α-helix	419-421	3
β-strand	430-434	5	1
β-strand	444-448	5	1
α-helix	459-460	2
β-strand	464	1	2
β-strand	468-475	8	2
α-helix	476-481	6
β-strand	486	1	1
β-strand	489-496	8	1

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	163-164	2	2
β-strand	173	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 3	A	protein	192	Homo sapiens	Q13114 (AlphaFold model)
Tumor necrosis factor receptor superfamily member 13C	B	protein	24

Sequence of entity 1 (A), FASTA

>2GKW_1 TNF receptor-associated factor 3 (chains A)
NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGK
TLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL
MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFI
KVIVDTSDLPDP

Sequence of entity 2 (B), FASTA

>2GKW_2 Tumor necrosis factor receptor superfamily member 13C (chains B)
SVPVPATELGSTELVTTKTAGPEQ

Primary citation

Key molecular contacts promote recognition of the BAFF receptor by TNF receptor-associated factor 3: implications for intracellular signaling regulation. Ni, C.-Z., Oganesyan, G., Welsh, K. et al. J Immunol (2004) 173:7394-7400. PubMed

Other PDB entries of the same protein (UniProt Q13114 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T5P 2.5 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF3 TRAF domain
1FLK 2.8 Å, Molecular basis for CD40 signaling mediated by TRAF3
1ZMS 2.8 Å, LMP1 Protein binds to TRAF3 as a structural CD40
8ZUK 2.83 Å, Cluster structure of the BAFF-BAFFR-TRAF3 complex
1L0A 2.9 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1FLL 3.5 Å, Molecular basis for CD40 signaling mediated by TRAF3
1KZZ 3.5 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1RF3 3.5 Å, Structurally Distinct Recognition Motifs in Lymphotoxin-B Receptor and CD40 for…
2ECY Solution structure of the Zinc finger, C3HC4 type (RING finger)" domain of TNF…

Browse structure collections

About this viewer

MolViewer shows 2GKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.