2GPP: Estrogen-related receptor gamma

Estrogen Related Receptor-gamma ligand binding domain complexed with a RIP140 peptide and synthetic ligand GSK4716. Determined by X-ray diffraction at 2.6 Å resolution. Released 26 Sept 2006.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,806
Mol. weight: 58.12 kDa
Ligands: 1BA
Released: 26 Sept 2006

Explore 2GPP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GPP contains 25 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	236-241	6
α-helix	245	1
α-helix	247	1
α-helix	261-284	24
α-helix	294-316	23
β-strand	324-327	4	1
β-strand	330-332	3	1
α-helix	334-340	7
α-helix	343-358	16
α-helix	363-375	13
α-helix	385-406	22
α-helix	413-418	6
α-helix	421-441	21
α-helix	448-454	7

Chain B: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	236-244	9
α-helix	261-284	24
α-helix	294-316	23
α-helix	317-319	3
β-strand	323-327	5	2
β-strand	330-333	4	2
α-helix	334-340	7
α-helix	343-359	17
α-helix	363-375	13
α-helix	385-406	22
α-helix	413-418	6
α-helix	421-441	21
α-helix	448-454	7

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	379-385	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen-related receptor gamma	A, B	protein	230	Homo sapiens	P62508 (AlphaFold model)
Nuclear receptor-interacting protein 1	C, D	protein	25		P48552 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2GPP_1 Estrogen-related receptor gamma (chains A, B)
PAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPG
FSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNA
ILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHM
EDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Sequence of entity 2 (C, D), FASTA

>2GPP_2 Nuclear receptor-interacting protein 1 (chains C, D)
LERNNIKQAANNSLLLHLLKSQTIP

Ligands and cofactors

ID	Name	Formula	Copies
1BA	4-hydroxy-N'-(4-isopropylbenzyl)benzohydrazide	C17 H20 N2 O2	1

Primary citation

X-ray crystal structures of the estrogen-related receptor-gamma ligand binding domain in three functional states reveal the molecular basis of small molecule regulation. Wang, L., Zuercher, W.J., Consler, T.G. et al. J Biol Chem (2006) 281:37773-37781. DOI 10.1074/jbc.M608410200 · PubMed

Other PDB entries of the same protein (UniProt P62508 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XXC 1.3 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6XY5 1.3 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6Y18 1.3 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6Y3W 1.34 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6Y1D 1.38 Å, Binary complex of 14-3-3 sigma (C38N) with the Estrogen Related Receptor gamma (DBD)…
8B4Q 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 5
8BJG 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 8
8BJN 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 6
8BM5 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 7
6I65 1.5 Å, Crystal structure of human ERRg LBD in complex with 4-iso-propylphenol
9KNG 1.5 Å, Crystal structure of human ERRg LBD in complex with 4034496
9KND 1.52 Å, Crystal structure of human ERRg LBD in complex with indole

Browse structure collections

About this viewer

MolViewer shows 2GPP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.