2GQJ: Zinc finger protein KIAA1196

Solution structure of the two zf-C2H2 like domains(493-575) of human zinc finger protein KIAA1196. Determined by solution NMR. Released 21 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 727
Mol. weight: 10.57 kDa
Ligands: ZN
Released: 21 Oct 2006

Explore 2GQJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GQJ contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	14-17	4
α-helix	39-55	17
α-helix	67-77	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc finger protein KIAA1196	A	protein	98	Homo sapiens	Q96KM6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GQJ_1 Zinc finger protein KIAA1196 (chains A)
GSSGSSGPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQHC
RKQFKSKAGLNYHTMAEHSAKPSDAEASEGGESGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structure of the two zf-C2H2 like domains(493-575) of human zinc finger protein KIAA1196. Kurosaki, C., Hayashi, F., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q96KM6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8TX8 2.2 Å, Crystal Structure of RBBP4 bound to ZNF512B peptide

Browse structure collections

About this viewer

MolViewer shows 2GQJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.