Crystal Structure of LIR-2 (ILT4) at 1.8 : differences from LIR-1 (ILT2) in regions implicated in the binding of the Cytomegalovirus class I MHC homolog UL18. Determined by X-ray diffraction at 1.8 Å resolution. Released 20 Jun 2006.
Explore 2GW5 in 3D Show helices and sheets RCSB PDB PDBe
2GW5 contains 6 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-17 | 3 | 2 |
| β-strand | 22-27 | 6 | 1 |
| β-strand | 34-40 | 7 | 3 |
| β-strand | 48-49 | 2 | 3 |
| α-helix | 50 | 1 | |
| α-helix | 52-54 | 3 | |
| β-strand | 55-56 | 2 | 1 |
| β-strand | 59-62 | 4 | 1 |
| β-strand | 71-79 | 9 | 3 |
| β-strand | 82-84 | 2 | 3 |
| α-helix | 85-90 | 6 | |
| β-strand | 91-93 | 3 | 3 |
| β-strand | 94-96 | 3 | 2 |
| β-strand | 103-107 | 5 | 4 |
| β-strand | 111 | 1 | 5 |
| β-strand | 118-128 | 11 | 4 |
| β-strand | 130-135 | 6 | 6 |
| β-strand | 144-146 | 3 | 6 |
| α-helix | 147-149 | 3 | |
| β-strand | 154-161 | 8 | 4 |
| β-strand | 171-177 | 7 | 6 |
| β-strand | 184 | 1 | 2 |
| β-strand | 185 | 1 | 6 |
| α-helix | 186-191 | 6 | |
| β-strand | 192-193 | 2 | 6 |
| β-strand | 195 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leukocyte immunoglobulin-like receptor subfamily B member 2 precursor | A | protein | 197 | Homo sapiens | Q8N423 (AlphaFold model) |
>2GW5_1 Leukocyte immunoglobulin-like receptor subfamily B member 2 precursor (chains A) GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQF HIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQ CESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNS PYVWSSPSDLLELLVPG
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
Crystal structure of LIR-2 (ILT4) at 1.8 A: differences from LIR-1 (ILT2) in regions implicated in the binding of the Human Cytomegalovirus class I MHC homolog UL18. Willcox, B.E., Thomas, L.M., Chapman, T.L. et al. BMC Struct Biol (2002) 2:6-6. DOI 10.1186/1472-6807-2-6 · PubMed
Other PDB entries of the same protein (UniProt Q8N423 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2GW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.