Methanethiol-Cys 112 Inhibition Complex of E. Coli Ketoacyl Synthase III (FabH) and Coenzyme A. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Jun 2007.
Explore 2GYO in 3D Show helices and sheets RCSB PDB PDBe
2GYO contains 33 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-11 | 10 | 1 |
| β-strand | 15-18 | 4 | 2 |
| α-helix | 19-25 | 7 | |
| α-helix | 30-37 | 8 | |
| β-strand | 41-44 | 4 | 2 |
| α-helix | 51-66 | 16 | |
| α-helix | 70-72 | 3 | |
| β-strand | 75-79 | 5 | 1 |
| β-strand | 85-87 | 3 | 3 |
| α-helix | 90-98 | 9 | |
| β-strand | 102 | 1 | 4 |
| β-strand | 105-109 | 5 | 1 |
| α-helix | 111-113 | 3 | |
| α-helix | 114-128 | 15 | |
| β-strand | 133-140 | 8 | 1 |
| α-helix | 151-154 | 4 | |
| β-strand | 157 | 1 | 5 |
| β-strand | 160-169 | 10 | 1 |
| β-strand | 174-181 | 8 | 6 |
| α-helix | 183-188 | 6 | |
| β-strand | 189-190 | 2 | 7 |
| β-strand | 191-192 | 2 | 8 |
| β-strand | 206-207 | 2 | 7 |
| α-helix | 209-230 | 22 | |
| α-helix | 235-237 | 3 | |
| β-strand | 240-243 | 4 | 6 |
| α-helix | 248-257 | 10 | |
| α-helix | 262-264 | 3 | |
| β-strand | 265 | 1 | 6 |
| α-helix | 269-272 | 4 | |
| β-strand | 274 | 1 | 5 |
| α-helix | 276-278 | 3 | |
| α-helix | 279-289 | 11 | |
| β-strand | 298-305 | 8 | 6 |
| β-strand | 309-316 | 8 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-11 | 10 | 1 |
| β-strand | 15-18 | 4 | 9 |
| α-helix | 19-25 | 7 | |
| α-helix | 30-36 | 7 | |
| β-strand | 41-44 | 4 | 9 |
| α-helix | 51-66 | 16 | |
| α-helix | 70-72 | 3 | |
| β-strand | 75-79 | 5 | 1 |
| β-strand | 85-87 | 3 | 8 |
| α-helix | 90-97 | 8 | |
| β-strand | 102 | 1 | 6 |
| β-strand | 105-109 | 5 | 1 |
| α-helix | 111-113 | 3 | |
| α-helix | 114-127 | 14 | |
| β-strand | 133-140 | 8 | 1 |
| α-helix | 151-154 | 4 | |
| β-strand | 157 | 1 | 10 |
| β-strand | 160-169 | 10 | 1 |
| β-strand | 174-181 | 8 | 4 |
| α-helix | 183-188 | 6 | |
| β-strand | 189-190 | 2 | 11 |
| β-strand | 191-192 | 2 | 3 |
| α-helix | 193-194 | 2 | |
| β-strand | 206-207 | 2 | 11 |
| α-helix | 209-230 | 22 | |
| α-helix | 235-237 | 3 | |
| β-strand | 240-243 | 4 | 4 |
| α-helix | 248-258 | 11 | |
| α-helix | 262-264 | 3 | |
| β-strand | 265 | 1 | 4 |
| α-helix | 269-272 | 4 | |
| β-strand | 274 | 1 | 10 |
| α-helix | 276-278 | 3 | |
| α-helix | 279-289 | 11 | |
| β-strand | 298-305 | 8 | 4 |
| β-strand | 309-316 | 8 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 3-oxoacyl-[acyl-carrier-protein] synthase 3 | A, B | protein | 317 | Escherichia coli | P0A6R0 (AlphaFold model) |
>2GYO_1 3-oxoacyl-[acyl-carrier-protein] synthase 3 (chains A, B) MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAAT RAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALS VADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLH ADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDW LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVL LEAFGGGFTWGSALVRF
Water and common crystallization additives (SO4) are not listed.
Alkyl-CoA Disulfides as Inhibitors and Mechanistic Probes for FabH Enzymes. Alhamadsheh, M.M., Musayev, F., Komissarov, A.A. et al. Chem Biol (2007) 14:513-524. DOI 10.1016/j.chembiol.2007.03.013 · PubMed
Other PDB entries of the same protein (UniProt P0A6R0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2GYO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.