Crystal structure of SARS-CoV main protease with authentic N and C-termini. Determined by X-ray diffraction at 1.6 Å resolution. Released 3 Apr 2007.
Explore 2H2Z in 3D Show helices and sheets RCSB PDB PDBe
2H2Z contains 17 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-9 | 3 | |
| α-helix | 11-14 | 4 | |
| β-strand | 17-22 | 6 | 1 |
| β-strand | 25-32 | 8 | 1 |
| β-strand | 35-39 | 5 | 1 |
| α-helix | 40-43 | 4 | |
| α-helix | 48-50 | 3 | |
| α-helix | 54-59 | 6 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-70 | 5 | 1 |
| β-strand | 73-75 | 3 | 1 |
| α-helix | 76 | 1 | |
| β-strand | 77-83 | 7 | 1 |
| β-strand | 86-91 | 6 | 1 |
| α-helix | 98-99 | 2 | |
| β-strand | 100-103 | 4 | 2 |
| α-helix | 106-107 | 2 | |
| β-strand | 111-118 | 8 | 2 |
| β-strand | 121-129 | 9 | 2 |
| β-strand | 136 | 1 | 2 |
| β-strand | 148-153 | 6 | 2 |
| β-strand | 156-166 | 11 | 2 |
| β-strand | 172-175 | 4 | 2 |
| α-helix | 180 | 1 | |
| β-strand | 181 | 1 | 2 |
| β-strand | 199 | 1 | 3 |
| α-helix | 201-213 | 13 | |
| α-helix | 227-236 | 10 | |
| β-strand | 239 | 1 | 3 |
| α-helix | 240-242 | 3 | |
| α-helix | 244-249 | 6 | |
| α-helix | 251-257 | 7 | |
| α-helix | 261-274 | 14 | |
| β-strand | 281 | 1 | 4 |
| β-strand | 284 | 1 | 4 |
| α-helix | 293-299 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Replicase polyprotein 1ab | A | protein | 306 | SARS coronavirus | P0C6U8 |
>2H2Z_1 Replicase polyprotein 1ab (chains A) SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC SGVTFQ
Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction. Xue, X., Yang, H., Shen, W. et al. J Mol Biol (2007) 366:965-975. DOI 10.1016/j.jmb.2006.11.073 · PubMed
Other PDB entries of the same protein (UniProt P0C6U8), best resolution first:
MolViewer shows 2H2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.