Crystal structure of HIF prolyl hydroxylase EGLN-1 in complex with a biologically active inhibitor. Determined by X-ray diffraction at 1.6 Å resolution. Released 27 Jun 2006.
Explore 2HBT in 3D Show helices and sheets RCSB PDB PDBe
2HBT contains 9 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-193 | 4 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-204 | 6 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 216-231 | 16 | |
| β-strand | 240-242 | 3 | 2 |
| β-strand | 251-252 | 2 | 2 |
| β-strand | 255-259 | 5 | 1 |
| α-helix | 267-282 | 16 | |
| β-strand | 292-295 | 4 | 1 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-303 | 6 | 1 |
| β-strand | 310-313 | 4 | 3 |
| β-strand | 322-329 | 8 | 1 |
| β-strand | 331 | 1 | 4 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 5 |
| β-strand | 343-345 | 3 | 3 |
| β-strand | 354-356 | 3 | 3 |
| β-strand | 359 | 1 | 4 |
| β-strand | 362-367 | 6 | 1 |
| β-strand | 374-376 | 3 | 3 |
| α-helix | 377-378 | 2 | |
| β-strand | 379 | 1 | 5 |
| β-strand | 383-392 | 10 | 1 |
| α-helix | 393-402 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egl nine homolog 1 | A | protein | 247 | Homo sapiens | Q9GZT9 (AlphaFold model) |
>2HBT_1 Egl nine homolog 1 (chains A) MAHHHHHHLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQ LVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAM VACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPK FDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSD SVGKDVF
| ID | Name | Formula | Copies |
|---|---|---|---|
| UN9 | N-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine | C12 H9 Cl N2 O4 | 1 |
| FE2 | FE (II) ion | Fe | 1 |
Crystal structure of HIF prolyl hydroxylase in complex with a biologically active inhibitor. Evdokimov, A.G., Walter, R.L., Mekel, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q9GZT9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2HBT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.