Crystal structure of the Src Homology-2 domain of the adapter protein SH2-B. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Aug 2006.
Explore 2HDV in 3D Show helices and sheets RCSB PDB PDBe
2HDV contains 9 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 522-524 | 3 | |
| β-strand | 528-531 | 4 | 1 |
| α-helix | 534-542 | 9 | |
| α-helix | 545-548 | 4 | |
| β-strand | 551-556 | 6 | 1 |
| β-strand | 563-570 | 8 | 1 |
| β-strand | 573-581 | 9 | 1 |
| β-strand | 587-589 | 3 | 1 |
| β-strand | 592-594 | 3 | 1 |
| α-helix | 597-604 | 8 | |
| β-strand | 623-624 | 2 | 1 |
| α-helix | 625-626 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 528-531 | 4 | 2 |
| α-helix | 534-542 | 9 | |
| α-helix | 545-548 | 4 | |
| β-strand | 551-556 | 6 | 2 |
| β-strand | 563-570 | 8 | 2 |
| β-strand | 573-581 | 9 | 2 |
| β-strand | 587-589 | 3 | 2 |
| β-strand | 592-594 | 3 | 2 |
| α-helix | 597-603 | 7 | |
| α-helix | 608-610 | 3 | |
| β-strand | 623-624 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SH2-B PH domain containing signaling mediator 1 gamma isoform | A, B | protein | 111 | Mus musculus | Q91ZM2 (AlphaFold model) |
>2HDV_1 SH2-B PH domain containing signaling mediator 1 gamma isoform (chains A, B) GSDQPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGECVLTFNFQGKAKH LRLSLNAAGQCRVQHLHFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPS
Structural Basis for Phosphotyrosine Recognition by the Src Homology-2 Domains of the Adapter Proteins SH2-B and APS. Hu, J., Hubbard, S.R. J Mol Biol (2006) 361:69-79. DOI 10.1016/j.jmb.2006.05.070 · PubMed
Other PDB entries of the same protein (UniProt Q91ZM2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2HDV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.