2HDX: Src homology-2 domain of SH2-B

Crystal structure of the Src homology-2 domain of SH2-B in complex with Jak2 pTyr813 phosphopeptide. Determined by X-ray diffraction at 2.35 Å resolution. Released 8 Aug 2006.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Mus musculus
Chains: 12
Atoms: 5,693
Mol. weight: 81.99 kDa
Released: 8 Aug 2006

Explore 2HDX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HDX contains 27 α-helices and 54 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	522-524	3
β-strand	528	1	1
α-helix	534-541	8
α-helix	545-548	4
β-strand	551-556	6	1
β-strand	563-570	8	1
β-strand	573-581	9	1
β-strand	587-589	3	1
β-strand	592-594	3	1
α-helix	597-606	10
β-strand	611	1	2
β-strand	623-624	2	1

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	522-524	3
β-strand	528	1	3
α-helix	534-542	9
α-helix	545-548	4
β-strand	551-556	6	3
β-strand	563-570	8	3
β-strand	573-581	9	3
β-strand	587-589	3	3
β-strand	592-593	2	3
α-helix	597-606	10
α-helix	608-609	2
β-strand	611	1	4
β-strand	623-624	2	3

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	522-524	3
β-strand	528	1	5
α-helix	534-542	9
α-helix	545-548	4
β-strand	552-556	5	5
β-strand	563-570	8	5
β-strand	573-581	9	5
β-strand	587-589	3	5
β-strand	592-594	3	5
α-helix	597-606	10
β-strand	611	1	6
β-strand	624	1	5

Chains D and E: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	522-524	3
β-strand	528	1	7
α-helix	534-542	9
α-helix	545-548	4
β-strand	551-556	6	7
β-strand	563-570	8	7
β-strand	573-581	9	7
β-strand	587-589	3	7
β-strand	592-594	3	7
α-helix	597-606	10
α-helix	608-609	2
β-strand	611	1	8
β-strand	623-624	2	7

Chain F: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	522-524	3
β-strand	528	1	11
α-helix	534-542	9
α-helix	545-548	4
β-strand	551-556	6	11
β-strand	563-570	8	11
β-strand	573-581	9	11
β-strand	587-589	3	11
β-strand	592-594	3	11
α-helix	597-606	10
β-strand	611	1	12
β-strand	623-624	2	11

Chains G, H, I, J, K and L: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	816	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH2-B PH domain containing signaling mediator 1 gamma isoform	A, B, C, D, E, F	protein	111	Mus musculus	Q91ZM2 (AlphaFold model)
Jak2 protein	G, H, I, J, K, L	protein	11		Q62120 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>2HDX_1 SH2-B PH domain containing signaling mediator 1 gamma isoform (chains A, B, C, D, E, F)
GSDQPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGECVLTFNFQGKAKH
LRLSLNAAGQCRVQHLHFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPS

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>2HDX_2 Jak2 protein (chains G, H, I, J, K, L)
TPDYELLTEND

Primary citation

Structural Basis for Phosphotyrosine Recognition by the Src Homology-2 Domains of the Adapter Proteins SH2-B and APS. Hu, J., Hubbard, S.R. J Mol Biol (2006) 361:69-79. DOI 10.1016/j.jmb.2006.05.070 · PubMed

Other PDB entries of the same protein (UniProt Q91ZM2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HDV 2.0 Å, Crystal structure of the Src Homology-2 domain of the adapter protein SH2-B
8ATK The SH2 domain of mouse SH2B1

Browse structure collections

About this viewer

MolViewer shows 2HDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.