2HE4: Na/H exchange regulatory cofactor NHE-RF2

The crystal structure of the second PDZ domain of human NHERF-2 (SLC9A3R2) interacting with a mode 1 PDZ binding motif. Determined by X-ray diffraction at 1.45 Å resolution. Released 18 Jul 2006.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 840
Mol. weight: 9.99 kDa
Released: 18 Jul 2006

Explore 2HE4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HE4 contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	150-155	6	1
α-helix	156	1
β-strand	157	1	2
β-strand	160	1	2
β-strand	163-167	5	1
β-strand	174-179	6	1
α-helix	184-188	5
β-strand	195-199	5	1
β-strand	202-203	2	1
α-helix	209-216	8
β-strand	222-228	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) exchange regulatory cofactor NHE-RF2	A	protein	90	Homo sapiens	Q15599 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HE4_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF2 (chains A)
SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV
EGLRHAEVVASIKAREDEARLLVVGPSTRL

Primary citation

Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions. Elkins, J.M., Papagrigoriou, E., Berridge, G. et al. Protein Sci (2007) 16:683-694. DOI 10.1110/ps.062657507 · PubMed

Other PDB entries of the same protein (UniProt Q15599 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P0C 1.34 Å, Crystal Structure of NHERF2 PDZ1 Domain in Complex with LPA2
2OCS 1.5 Å, The crystal structure of the first PDZ domain of human NHERF-2 (SLC9A3R2)
2D11 2.81 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail…

Browse structure collections

About this viewer

MolViewer shows 2HE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.