The crystal structure of the first PDZ domain of human NHERF-2 (SLC9A3R2). Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Jan 2007.
Explore 2OCS in 3D Show helices and sheets RCSB PDB PDBe
2OCS contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-14 | 6 | 1 |
| β-strand | 22-26 | 5 | 1 |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 43-46 | 4 | |
| β-strand | 53-58 | 6 | 1 |
| β-strand | 61-62 | 2 | 1 |
| α-helix | 68-76 | 9 | |
| β-strand | 81-88 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Na(+)/H(+) exchange regulatory cofactor NHE-RF2 | A | protein | 88 | Homo sapiens | Q15599 (AlphaFold model) |
>2OCS_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF2 (chains A) MPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGE THHQVVQRIKAVEGQTRLLVVDQEDTSV
| ID | Name | Formula | Copies |
|---|---|---|---|
| SCN | Thiocyanate ion | C N S | 1 |
Water and common crystallization additives (EDO) are not listed.
The crystal structure of the first PDZ domain of human NHERF-2 (SLC9A3R2). Papagrigoriou, E., Phillips, C., Gileadi, C. et al. To be published.
Other PDB entries of the same protein (UniProt Q15599 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.