2HEH: KIF2C motor domain

Crystal Structure of the KIF2C motor domain. Determined by X-ray diffraction at 2.15 Å resolution. Released 18 Jul 2006.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,578
Mol. weight: 43.75 kDa
Ligands: ADP, MG
Released: 18 Jul 2006

Explore 2HEH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HEH contains 18 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	230-242	13
β-strand	246	1	1
α-helix	253-254	2
β-strand	259-265	7	2
α-helix	266-269	4
α-helix	270-274	5
β-strand	279	1	3
β-strand	281-282	2	4
β-strand	285	1	1
β-strand	288-296	9	4
β-strand	302-310	9	4
β-strand	313-315	3	2
α-helix	321-327	7
α-helix	330-337	8
β-strand	341-347	7	2
α-helix	354-358	5
α-helix	373-385	13
α-helix	388-391	4
β-strand	396-405	10	2
β-strand	408-411	4	2
β-strand	417-418	2	2
β-strand	420-423	4	5
β-strand	429-432	4	5
β-strand	437-439	3	2
α-helix	442-455	14
α-helix	467-469	3
β-strand	471-479	9	2
β-strand	484-492	9	2
α-helix	493-495	3
α-helix	514-531	18
α-helix	539-541	3
α-helix	543-547	5
α-helix	549-552	4
β-strand	557-565	9	2
β-strand	568	1	3
α-helix	569-571	3
α-helix	572-585	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIF2C protein	A	protein	387	Homo sapiens	Q99661 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HEH_1 KIF2C protein (chains A)
MGSSHHHHHHSSGLVPRGSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKR
PLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYR
FTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKN
QPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVI
KMIDMGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSAD
RQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIATIS
PGISSCEYTLNTLRYADRVKELSPHSG

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

Crystal structure of the kif2c motor domain. Wang, J., Shen, Y., Tempel, W. et al. To be published.

Other PDB entries of the same protein (UniProt Q99661 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Y05 2.59 Å, KIF2C short Loop2 construct
4UBF 3.0 Å, HsMCAK motor domain complex
5MIO 3.19 Å, KIF2C-darpin fusion protein bound to tubulin

Browse structure collections

About this viewer

MolViewer shows 2HEH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.