2HEV: Complex between OX40L and OX40

Crystal structure of the complex between OX40L and OX40. Determined by X-ray diffraction at 2.41 Å resolution. Released 29 Aug 2006.

Method: X-ray diffraction
Resolution: 2.41 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,182
Mol. weight: 32.11 kDa
Ligands: NAG
Released: 29 Aug 2006

Explore 2HEV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HEV contains 12 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	61-70	10	1
β-strand	74-78	5	1
β-strand	88-89	2	2
β-strand	92-94	3	2
α-helix	95	1
β-strand	97	1	3
β-strand	99-118	20	1
α-helix	124-125	2
β-strand	127-143	17	1
β-strand	148-149	2	2
β-strand	150-155	6	1
β-strand	165-174	10	1
β-strand	181	1	3

Chain R: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	35-38	4	4
β-strand	41-44	4	4
α-helix	45	1
β-strand	46	1	5
α-helix	47	1
β-strand	50-54	5	6
β-strand	63-66	4	6
β-strand	71-72	2	7
β-strand	77	1	5
α-helix	80-81	2
β-strand	82-83	2	7
α-helix	84-87	4
α-helix	89-91	3
β-strand	93-97	5	8
β-strand	100	1	9
β-strand	103	1	9
β-strand	106-109	4	8
α-helix	110	1
β-strand	113-115	3	10
α-helix	116	1
β-strand	125-127	3	10
α-helix	128-129	2
β-strand	132-133	2	11
α-helix	139-141	3
β-strand	142-143	2	11
α-helix	144-145	2
β-strand	153-156	4	12
β-strand	165-167	3	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor ligand superfamily member 4	F	protein	137	Homo sapiens	P23510 (AlphaFold model)
Tumor necrosis factor receptor superfamily member 4	R	protein	146	Homo sapiens	P43489 (AlphaFold model)

Sequence of entity 1 (F), FASTA

>2HEV_1 Tumor necrosis factor ligand superfamily member 4 (chains F)
GSHMQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQDNSVIINCDGFYLISLK
GYFSQEVDISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVN
GGELILIHQNPGEFCVL

Sequence of entity 2 (R), FASTA

>2HEV_2 Tumor necrosis factor receptor superfamily member 4 (chains R)
GSHMLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPC
TWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPW
TNCTLAGKHTLQPASNSSDAICEDRD

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

The Crystal Structure of the Costimulatory OX40-OX40L Complex. Compaan, D.M., Hymowitz, S.G. Structure (2006) 14:1321-1330. DOI 10.1016/j.str.2006.06.015 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2HEV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.