2HF3: Monomeric Actin in the ADP bound state

Crystal structure of monomeric Actin in the ADP bound state. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Aug 2006.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 3,360
Mol. weight: 42.23 kDa
Ligands: ADP, CA
Released: 29 Aug 2006

Explore 2HF3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HF3 contains 25 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	8-11	4	1
β-strand	16-21	6	1
β-strand	29-32	4	1
β-strand	35-38	4	2
β-strand	53-54	2	2
α-helix	56-60	5
α-helix	62-64	3
β-strand	65-68	4	2
α-helix	79-88	10
α-helix	89-94	6
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-121	9
α-helix	122-126	5
β-strand	131-136	6	1
α-helix	137-144	8
β-strand	150-155	6	3
β-strand	160-166	7	3
β-strand	169-170	2	3
α-helix	172-174	3
β-strand	176-178	3	3
α-helix	182-196	15
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	4
β-strand	247-250	4	4
α-helix	253-259	7
α-helix	264-267	4
α-helix	274-283	10
α-helix	287-289	3
α-helix	290-294	5
β-strand	297-300	4	3
α-helix	302-304	3
α-helix	309-320	12
β-strand	329-330	2	3
α-helix	335-337	3
α-helix	338-347	10
α-helix	350-355	6
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	369-373	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-5C	A	protein	374	Drosophila melanogaster	P10987 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HF3_1 Actin-5C (chains A)
DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA
GRDLTDYLMKILTERGYSFTTTEEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LKDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE
YDESGPSIVHRKCF

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
CA	Calcium ion	Ca	2

Primary citation

Crystal Structures of Expressed Non-polymerizable Monomeric Actin in the ADP and ATP States. Rould, M.A., Wan, Q., Joel, P.B. et al. J Biol Chem (2006) 281:31909-31919. DOI 10.1074/jbc.M601973200 · PubMed

Other PDB entries of the same protein (UniProt P10987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HF4 1.8 Å, Crystal structure of Monomeric Actin in its ATP-bound state
3EKS 1.8 Å, Crystal Structure of Monomeric Actin bound to Cytochalasin D
3MN6 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3MN7 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3MN9 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3EKU 2.5 Å, Crystal Structure of Monomeric Actin bound to Cytochalasin D
3EL2 2.5 Å, Crystal Structure of Monomeric Actin Bound to Ca-ATP
4M63 2.75 Å, Crystal Structure of a Filament-Like Actin Trimer Bound to the Bacterial Effector VopL
3MMV 2.8 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
4JHD 2.91 Å, Crystal Structure of an Actin Dimer in Complex with the Actin Nucleator Cordon-Bleu
4RWT 2.98 Å, Structure of actin-Lmod complex
5WFN 3.0 Å, Revised model of leiomodin 2-mediated actin regulation (alternate refinement of PDB 4RWT)

Browse structure collections

About this viewer

MolViewer shows 2HF3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.