2HKD: Engineered OSPA

The crystal structure of engineered OSPA. Determined by X-ray diffraction at 1.6 Å resolution. Released 21 Nov 2006.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Borreliella burgdorferi
Chains: 1
Atoms: 2,867
Mol. weight: 34.58 kDa
Released: 21 Nov 2006

Explore 2HKD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HKD contains 2 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29-34	6	1
β-strand	38-43	6	1
β-strand	52-58	7	1
β-strand	61-67	7	1
β-strand	74-79	6	1
β-strand	85-90	6	1
β-strand	96-102	7	1
β-strand	109-116	8	1
β-strand	121-126	6	1
β-strand	132-138	7	1
β-strand	144-149	6	1
β-strand	155-161	7	1
β-strand	167-172	6	1
β-strand	178-184	7	1
β-strand	190-195	6	1
β-strand	201-207	7	1
β-strand	213-217	5	1
β-strand	225-231	7	1
β-strand	234-240	7	1
β-strand	245-251	7	1
β-strand	254-260	7	1
β-strand	266-272	7	1
β-strand	281-286	6	2
β-strand	291-296	6	2
β-strand	299-306	8	2
β-strand	312-316	5	2
β-strand	317	1	3
α-helix	318	1
β-strand	324	1	3
β-strand	329-330	2	2
α-helix	334-340	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer Surface Protein A	A	protein	320	Borreliella burgdorferi	P0CL66 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HKD_1 Outer Surface Protein A (chains A)
GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKAD
ASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADK
SSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVS
EKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISK
SGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGT
SLEGSAVEITKLDEIKNALK

Primary citation

Atomic structures of peptide self-assembly mimics. Makabe, K., McElheny, D., Tereshko, V. et al. Proc Natl Acad Sci U S A (2006) 103:17753-17758. DOI 10.1073/pnas.0606690103 · PubMed

Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I5V 1.1 Å, Crystal structure of OspA mutant
2G8C 1.15 Å, Atomic-resolution crystal structure of Borrelia burgdorferi OspA via surface entropy…
2I5Z 1.2 Å, The crystal structure of OspA mutant
6J48 1.2 Å, Glycine mutation on single layer beta-sheet of OspAsm1
9WVV 1.27 Å, The crystal structure of OspA mutant
2OYB 1.3 Å, The crystal structure of OspA mutant
2OL7 1.35 Å, The crystal structure of OspA mutant
6KWV 1.37 Å, A Crystal Structure of OspA mutant
2PI3 1.4 Å, The crystal structure of OspA mutant
6ICS 1.4 Å, Loop deletion mutant (deleting four residues)
6KT1 1.43 Å, Crystal structure of an OspA mutant
6KWU 1.43 Å, A Crystal Structure of OspA mutant

Browse structure collections

About this viewer

MolViewer shows 2HKD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.