2HKF: Complex Fab M75- Peptide

Crystal structure of the Complex Fab M75- Peptide. Determined by X-ray diffraction at 2.01 Å resolution. Released 13 Nov 2007.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,666
Mol. weight: 48.47 kDa
Released: 13 Nov 2007

Explore 2HKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HKF contains 14 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
β-strand	33-39	7	8
β-strand	46-51	6	8
α-helix	54-56	3
β-strand	60-62	3	8
β-strand	67	1	7
β-strand	70-75	6	7
α-helix	76-78	3
β-strand	80-85	6	7
α-helix	90-92	3
β-strand	94-101	8	8
β-strand	109	1	8
β-strand	113-117	5	8
β-strand	123	1	9
α-helix	124-125	2
β-strand	126-130	5	10
β-strand	141-151	11	10
β-strand	152	1	9
β-strand	157-160	4	11
β-strand	169-177	9	10
β-strand	180-190	11	10
β-strand	200-205	6	11
α-helix	206-208	3
β-strand	210-215	6	11

Chain L: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-160	3	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-193	6
β-strand	196-203	8	6
β-strand	206-215	10	6
α-helix	216-218	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin Light chain Fab fragment	L	protein	219	Mus musculus	P01631 (AlphaFold model)
Immunoglobulin Heavy chain Fab fragment	H	protein	218	Mus musculus
Carbonic anhydrase 9	P	protein	9		Q16790 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>2HKF_1 Immunoglobulin Light chain Fab fragment (chains L)
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>2HKF_2 Immunoglobulin Heavy chain Fab fragment (chains H)
EVQVVESGGGLVQPKGSLKLSCVVSGSTLNNYAMNWVRQAPGKGLEWVARIRSKSNNYAT
YYADSVKDRFTISRDDSQSMIYLQMNNLKTEDTAMYYCVTYGNHPFAYWGQGTLVTVSAA
KTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGL
YTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP

Sequence of entity 3 (P), FASTA

>2HKF_3 Carbonic anhydrase 9 (chains P)
LPGEEDLPG

Primary citation

Stabilization of antibody structure upon association to a human carbonic anhydrase IX epitope studied by X-ray crystallography, microcalorimetry, and molecular dynamics simulations. Kral, V., Mader, P., Collard, R. et al. Proteins (2008) 71:1275-1287. DOI 10.1002/prot.21821 · PubMed

Other PDB entries of the same protein (UniProt P01631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DLF 1.45 Å, High resolution crystal structure of the fv fragment from an anti-dansyl switch variant…
2DLF 1.55 Å, High resolution crystal structure of the fv fragment from an anti-dansyl switch variant…
1N4X 1.7 Å, Structure of scFv 1696 at acidic pH
1WZ1 1.85 Å, Crystal structure of the Fv fragment complexed with dansyl-lysine
1SVZ 1.89 Å, Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope…
2IPT 2.0 Å, PFA1 Fab Fragment
2IQA 2.0 Å, PFA2 FAB fragment, monoclinic apo form
2O5X 2.05 Å, Crystal structure of 1E9 LeuH47Trp/ArgH100Trp, an engineered Diels-Alderase Fab with nM…
1BFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
1CFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
2HKH 2.1 Å, Crystal structure of the Fab M75
2O5Z 2.4 Å, Crystal structure of the 1E9 LeuH47Trp/ArgH100Trp Fab 5-beta-androstane-3,17-dione complex

Browse structure collections

About this viewer

MolViewer shows 2HKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.