2HKP: Ubiquitin-like-specific protease 1

SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfenic acid. Determined by X-ray diffraction at 2.1 Å resolution. Released 31 Jul 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,898
Mol. weight: 25.67 kDa
Released: 31 Jul 2007

Explore 2HKP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HKP contains 13 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	405-408	4
α-helix	409-420	12
β-strand	426-430	5	1
β-strand	433-436	4	1
α-helix	437-440	4
α-helix	441-443	3
α-helix	451-463	13
β-strand	468-470	3	2
α-helix	474-482	9
α-helix	484-487	4
α-helix	490-493	4
α-helix	498-500	3
β-strand	503-510	8	2
β-strand	514-521	8	2
β-strand	526-530	5	2
α-helix	539-555	17
β-strand	565-568	4	2
α-helix	572-574	3
α-helix	580-592	13
α-helix	601-616	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like-specific protease 1	A	protein	221	Saccharomyces cerevisiae	Q02724 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HKP_1 Ubiquitin-like-specific protease 1 (chains A)
GSLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKY
IEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGII
DLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDC
GIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK

Primary citation

Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation. Xu, Z., Lam, L.S.M., Lam, L.H. et al. FASEB J (2008) 22:127-137. DOI 10.1096/fj.06-7871com · PubMed

Other PDB entries of the same protein (UniProt Q02724 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EUV 1.6 Å, X-ray structure of the C-terminal ULP1 protease domain in complex with SMT3, the yeast…
2HL9 1.9 Å, SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfonic acid
2HL8 2.0 Å, SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfinic acid
5H2X 2.2 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-172)
5H2W 2.5 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-340)
5H2V 2.8 Å, Crystal structure of the karyopherin Kap121p bound to the SUMO protease Ulp1p

Browse structure collections

About this viewer

MolViewer shows 2HKP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.