1EUV: C-terminal ULP1 protease domain

X-ray structure of the C-terminal ULP1 protease domain in complex with SMT3, the yeast ortholog of sumo. Determined by X-ray diffraction at 1.6 Å resolution. Released 7 Jun 2000.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,849
Mol. weight: 35.61 kDa
Released: 7 Jun 2000

Explore 1EUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EUV contains 18 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	405-408	4
α-helix	409-419	11
β-strand	426-430	5	1
β-strand	433-436	4	1
α-helix	437-440	4
α-helix	441-443	3
α-helix	447-449	3
β-strand	450	1	2
α-helix	451-464	14
β-strand	468-470	3	3
α-helix	474-482	9
α-helix	484-486	3
α-helix	492-494	3
α-helix	498-500	3
β-strand	503-510	8	3
β-strand	514-521	8	3
β-strand	526-530	5	3
α-helix	539-555	17
α-helix	564	1
β-strand	565-569	5	3
α-helix	572-574	3
α-helix	580-592	13
α-helix	601-616	16

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	23-29	7	4
β-strand	34-40	7	4
α-helix	46-55	10
α-helix	60-62	3
β-strand	63-67	5	4
β-strand	70-71	2	4
α-helix	72-73	2
β-strand	74	1	5
β-strand	76	1	5
β-strand	87-93	7	4
β-strand	96	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ULP1 protease	A	protein	221	Saccharomyces cerevisiae	Q02724 (AlphaFold model)
Ubitqutin-like protein SMT3	B	protein	86	Saccharomyces cerevisiae	Q12306 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EUV_1 ULP1 PROTEASE (chains A)
GSLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKY
IEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGII
DLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDC
GIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK

Sequence of entity 2 (B), FASTA

>1EUV_2 UBITQUTIN-LIKE PROTEIN SMT3 (chains B)
EVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRI
QADQTPEDLDMEDNDIIEAHREQIGG

Primary citation

Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast. Mossessova, E., Lima, C.D. Mol Cell (2000) 5:865-876. DOI 10.1016/S1097-2765(00)80326-3 · PubMed

Other PDB entries of the same protein (UniProt Q02724 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HL9 1.9 Å, SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfonic acid
2HL8 2.0 Å, SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfinic acid
2HKP 2.1 Å, SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfenic acid
5H2X 2.2 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-172)
5H2W 2.5 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-340)
5H2V 2.8 Å, Crystal structure of the karyopherin Kap121p bound to the SUMO protease Ulp1p

Browse structure collections

About this viewer

MolViewer shows 1EUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.