2HMH: SOCS3

Crystal structure of SOCS3 in complex with gp130(pTyr757) phosphopeptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Aug 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,109
Mol. weight: 18.33 kDa
Released: 15 Aug 2006

Explore 2HMH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HMH contains 7 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	32-43	12
β-strand	47-48	2	1
α-helix	53-61	9
α-helix	64	1
β-strand	67-72	6	1
β-strand	80-86	7	1
β-strand	89-94	6	1
β-strand	95-96	2	2
α-helix	98-100	3
β-strand	102	1	3
β-strand	103-104	2	2
β-strand	106	1	4
α-helix	113-115	3
β-strand	117	1	3
α-helix	120-126	7
β-strand	142-144	3	4
β-strand	151-153	3	4
β-strand	157-158	2	1
α-helix	159-161	3

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	757	1	1
β-strand	760-761	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor of cytokine signaling 3	A	protein	152	Mus musculus	O35718 (AlphaFold model)
Interleukin-6 receptor beta chain	B	protein	11		Q00560 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HMH_1 Suppressor of cytokine signaling 3 (chains A)
GSEFPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLI
RDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPP
QALPGSTPKRAYYIYSGGEKIPLVLSRPLSSN

Sequence of entity 2 (B), FASTA

>2HMH_2 Interleukin-6 receptor beta chain (chains B)
STVEYSTVVHS

Primary citation

Structural basis for phosphotyrosine recognition by suppressor of cytokine signaling-3. Bergamin, E., Wu, J., Hubbard, S.R. Structure (2006) 14:1285-1292. DOI 10.1016/j.str.2006.06.011 · PubMed

Other PDB entries of the same protein (UniProt O35718 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GL9 3.9 Å, Crystal structure of inhibitory protein SOCS3 in complex with JAK2 kinase domain and…
2BBU solution structure of mouse socs3 in complex with a phosphopeptide from the gp130 receptor
2JZ3 SOCS box elonginBC ternary complex

Browse structure collections

About this viewer

MolViewer shows 2HMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.